SecReT4
Protein ID: 21264264
T4SS name [ID]VirB [361]
Gene symbolvirB1
Locus tagXACb0036
StrainXanthomonas axonopodis pv. citri str. 306
Repliconplasmid pXAC64 [GenBank: NC_003922] [Browse all T4SS(s) in this replicon]
Location [Strand]33079..33957 [-]
ProductVirB1 protein
Component typeVirB1
UniProt IDQ8PRJ6
KEGG IDxac:XACb0036
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 292 a.a.     [Download]
>gi|21264264|ref|NP_644764.1| VirB1 protein [Xanthomonas axonopodis pv. citri str. 306]
MAAGLLAAVPLFAGAQTPAQPLAFEKLAAECAPDVHPTTLKGVVSTESSWNPYAIGVVGGRLDRQPRSLA
EAVATARELERQGFNFSMGLGQVNRYNLAKYGESYETVFEPCRNLKAGSVILKDCFQRAKAQMGDDQQAL
RAAFSCYYSGNFTRGFRPDKAGQPSYVQKVVAKATGAAQPIPVVPAVKPESSVAVRPAGRPAGPAKQAAA
PSEWVIFADGAQPSGQSVAPTHAESAKEPAVQVQLVTPVAAPAATAGRAERVQTQREAQAVPVQRATANS
AQQDAPFVQFVN
 
Nucleotide Sequence: 879 bp     [Download]
>gi|21264228|ref|NC_003922.1|:c33957-33079 Xanthomonas axonopodis pv. citri str. 306 plasmid pXAC64, complete sequence
ATGGCGGCAGGGCTGTTGGCCGCTGTTCCGCTGTTCGCCGGCGCACAAACGCCGGCGCAGCCCCTGGCGT
TTGAAAAGCTGGCTGCCGAGTGCGCCCCGGACGTTCACCCGACCACGCTCAAGGGCGTGGTGAGCACCGA
ATCGTCGTGGAATCCCTATGCGATCGGCGTCGTGGGCGGCCGCCTCGATCGTCAGCCGCGTAGTTTGGCC
GAAGCGGTGGCCACGGCTCGTGAGCTTGAGCGGCAGGGCTTCAATTTCTCGATGGGCTTGGGGCAGGTCA
ATCGTTACAACCTCGCCAAATATGGCGAGAGCTACGAGACCGTGTTCGAGCCGTGCCGCAATCTCAAGGC
GGGCAGCGTGATCCTCAAAGACTGCTTTCAGCGCGCCAAGGCGCAGATGGGTGACGATCAGCAAGCCTTG
CGGGCCGCGTTCAGTTGCTACTACTCGGGCAACTTCACGCGCGGCTTTCGACCGGACAAAGCGGGGCAGC
CGAGCTATGTGCAGAAGGTCGTAGCGAAGGCGACGGGGGCGGCTCAGCCGATCCCCGTTGTGCCTGCCGT
GAAGCCCGAAAGCTCCGTAGCCGTTCGCCCTGCTGGTCGGCCTGCAGGGCCGGCGAAACAGGCTGCGGCG
CCGAGCGAATGGGTGATCTTCGCGGACGGAGCGCAGCCAAGCGGCCAGTCGGTCGCACCCACGCATGCGG
AGTCGGCCAAAGAGCCGGCCGTCCAGGTCCAGCTCGTGACGCCGGTCGCTGCACCGGCCGCTACGGCAGG
TCGTGCCGAGCGAGTGCAGACCCAACGCGAAGCGCAAGCCGTCCCCGTGCAACGGGCGACGGCGAACAGC
GCTCAGCAGGACGCGCCTTTCGTGCAGTTTGTGAATTGA
 Primer design