SecReT4
Protein ID: 21264265
T4SS name [ID]VirB [361]
Gene symbolvirB11
Locus tagXACb0037
StrainXanthomonas axonopodis pv. citri str. 306
Repliconplasmid pXAC64 [GenBank: NC_003922] [Browse all T4SS(s) in this replicon]
Location [Strand]33968..34990 [-]
ProductVirB11 protein
Component typeVirB11
UniProt IDQ8PRJ5
KEGG IDxac:XACb0037
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.7e-68, Aligned region: 13..323
Protein Sequence: 340 a.a.     [Download]
>gi|21264265|ref|NP_644765.1| VirB11 protein [Xanthomonas axonopodis pv. citri str. 306]
MSQIASFRTKLSLLADYLDDKQVTEIQVNKPGELWLRKKDAYYAEQIEVPGLTYQLLSSLAEVTASFKSL
EVDRDSPILSAEIPVNLDDGVPDFERGTYRTEMILPPVVPEGTIAMTIRKQSLVRMSLPKYREQGAFRFV
NSDVLDEPYSDARLLDLYRANEWDEFLRGAVLAHKNIVISAGTYCGKTTCLNALVQEIPAHERIVTIEDS
REIEPAQPNCVRLSYARHQASGQAAVTPTTLLRSCMRLTPDRVIMGEIRGPEAVEFLNMLNTGHKGSLTT
IHTDSPAEMYDRFGELMDGHTSMTREQVIARVKRRIDVVVQWKYTERNGRYISEIIYAGA
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|21264228|ref|NC_003922.1|:c34990-33968 Xanthomonas axonopodis pv. citri str. 306 plasmid pXAC64, complete sequence
ATGTCGCAGATTGCCTCCTTCCGTACCAAGCTCTCCTTGCTGGCCGACTATCTCGATGACAAGCAGGTCA
CCGAGATTCAGGTCAACAAGCCGGGAGAGCTTTGGCTGCGAAAGAAAGACGCGTACTACGCCGAGCAAAT
CGAAGTGCCGGGGCTGACATATCAGTTGCTCTCGTCGCTGGCCGAAGTCACGGCGTCTTTCAAGAGTCTG
GAAGTTGACCGGGATAGTCCGATTCTCTCGGCCGAAATCCCGGTCAACCTCGATGACGGTGTTCCAGACT
TCGAGCGCGGAACGTATCGCACGGAAATGATTCTTCCGCCTGTCGTACCGGAGGGCACCATCGCGATGAC
GATTCGCAAACAGTCGCTGGTTCGGATGAGCCTGCCGAAGTACAGGGAGCAGGGCGCTTTTCGGTTCGTG
AATAGCGACGTGCTCGATGAGCCGTATTCCGATGCTCGCTTGCTGGACCTGTATCGCGCGAATGAGTGGG
ACGAATTTCTGCGCGGCGCAGTGTTGGCCCACAAGAACATTGTCATATCGGCCGGAACGTACTGCGGCAA
GACCACGTGCCTCAATGCGTTGGTGCAGGAAATCCCTGCACACGAGCGGATCGTCACGATTGAAGACTCG
CGGGAGATCGAACCTGCGCAACCAAACTGCGTGCGACTTTCTTACGCGCGCCATCAGGCGTCGGGGCAAG
CTGCCGTAACGCCCACAACGTTGCTTCGCTCGTGCATGCGACTCACGCCCGACCGGGTCATCATGGGCGA
GATTCGCGGCCCGGAAGCGGTTGAGTTCTTGAACATGCTCAACACGGGCCACAAGGGGTCGCTCACGACG
ATTCACACCGATTCGCCGGCCGAAATGTACGACCGTTTTGGCGAGTTGATGGACGGTCACACATCCATGA
CGCGCGAGCAGGTCATCGCGCGCGTCAAGCGGCGAATCGATGTTGTTGTGCAGTGGAAATACACCGAGCG
CAACGGCCGCTACATCTCGGAGATCATCTATGCAGGTGCGTAA
 Primer design