SecReT4
Protein ID: 21264266
T4SS name [ID]VirB [361]
Gene symbolvirB10
Locus tagXACb0038
StrainXanthomonas axonopodis pv. citri str. 306
Repliconplasmid pXAC64 [GenBank: NC_003922] [Browse all T4SS(s) in this replicon]
Location [Strand]35001..36221 [-]
ProductVirB10 protein
Component typeVirB10
UniProt IDQ8PRJ4
KEGG IDxac:XACb0038
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 4.1e-58, Aligned region: 206..385
Protein Sequence: 406 a.a.     [Download]
>gi|21264266|ref|NP_644766.1| VirB10 protein [Xanthomonas axonopodis pv. citri str. 306]
MSDQTNKPQEDREAAVREWEKQANASLVADDRKKKMSGIAIAAIAAVGLGAVWYMKHGGSEPAKPVGNSE
LSIPERKPVPKLKEQESASAAAVTSTPAATPANATQADDPMKAQREQMEMQRQEQERRMLEARRKSAIIP
PNSNNQAAASAQPAGDSGDQGQSNAGMLGGGSGDRGAQDPNSRFARAVSGDDVAVSKANQIDNLPYKVLQ
GKLIEAVLEPRAISDLPGMVCATVQRDVYGAQDRNKLIPWGSRVCGVYSAEVRKGQDRLFVIWNTVRRPD
GVQVALDSAGADQLGTAGMGGIVDTHFAGIFGTSALLSIIGAGASNAGVSSGDQYNSAAAYRQSVQQAAA
QTSQSVLQPYINIPPTITVPAGSRVRIYVNKDLDFTAIYKDEIDGAKRGDGVTFIQ
 
Nucleotide Sequence: 1221 bp     [Download]
>gi|21264228|ref|NC_003922.1|:c36221-35001 Xanthomonas axonopodis pv. citri str. 306 plasmid pXAC64, complete sequence
ATGAGCGATCAGACAAACAAGCCGCAGGAGGACCGCGAGGCGGCCGTGCGAGAGTGGGAAAAGCAGGCCA
ATGCCTCGTTGGTGGCCGATGATCGCAAGAAGAAGATGAGCGGTATCGCGATTGCTGCCATCGCGGCCGT
TGGCCTCGGTGCGGTCTGGTACATGAAGCACGGCGGTAGCGAGCCGGCGAAGCCTGTGGGCAACAGCGAA
CTGAGCATTCCAGAGCGTAAGCCGGTGCCGAAGCTCAAGGAGCAGGAGTCGGCCAGCGCGGCGGCAGTGA
CTTCCACTCCGGCCGCGACGCCTGCGAACGCAACGCAGGCCGATGACCCGATGAAAGCCCAACGCGAACA
GATGGAAATGCAGCGGCAGGAACAAGAGCGGCGGATGCTCGAAGCCCGCAGGAAGTCGGCCATCATCCCG
CCGAACTCCAACAACCAGGCGGCAGCGTCTGCGCAGCCGGCGGGCGACAGCGGCGACCAAGGGCAGTCGA
ATGCCGGCATGCTAGGCGGCGGTAGTGGCGACCGTGGCGCGCAAGACCCGAATTCGCGTTTTGCGCGGGC
TGTCTCTGGCGATGACGTGGCGGTCAGCAAGGCAAATCAAATCGACAACCTGCCCTACAAGGTCTTGCAG
GGCAAGCTCATCGAGGCCGTGCTTGAGCCGCGGGCAATCTCCGATCTGCCCGGCATGGTGTGTGCGACCG
TTCAGCGCGACGTGTACGGCGCGCAAGACCGGAACAAGCTGATTCCGTGGGGTTCGCGCGTATGCGGCGT
GTACAGCGCCGAAGTCCGCAAGGGGCAAGACCGGCTGTTCGTGATCTGGAACACCGTACGCCGGCCGGAT
GGCGTGCAAGTGGCGCTCGACAGTGCGGGCGCTGACCAGCTCGGCACTGCCGGCATGGGCGGCATCGTGG
ACACGCATTTTGCTGGAATCTTCGGCACGTCCGCGCTGCTGTCGATCATCGGCGCTGGCGCGTCGAACGC
CGGCGTGAGTTCGGGCGATCAGTACAACTCGGCCGCCGCCTATCGGCAATCGGTGCAACAGGCGGCCGCG
CAAACCTCGCAGTCGGTGCTACAGCCGTACATCAATATCCCGCCGACCATCACCGTGCCGGCCGGCTCGC
GCGTTCGCATCTACGTGAACAAAGACCTCGATTTCACGGCGATCTACAAGGATGAAATCGACGGAGCCAA
GCGCGGCGACGGCGTGACGTTCATCCAGTGA
 Primer design