SecReT4
Protein ID: 21264267
T4SS name [ID]VirB [361]
Gene symbolvirB9
Locus tagXACb0039
StrainXanthomonas axonopodis pv. citri str. 306
Repliconplasmid pXAC64 [GenBank: NC_003922] [Browse all T4SS(s) in this replicon]
Location [Strand]36223..37005 [-]
ProductVirB9 protein
Component typeVirB9
UniProt IDQ8PRJ3
KEGG IDxac:XACb0039
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.4e-65, Aligned region: 37..242
Protein Sequence: 260 a.a.     [Download]
>gi|21264267|ref|NP_644767.1| VirB9 protein [Xanthomonas axonopodis pv. citri str. 306]
MKFNPVPLAVALIAGTSISLAWVPAHAAKLPHSLVTDDRVKQVPYDPNQVYEIVGTYGYQTSIEFANDET
VKVVTLGDSIAWQTVPYQNRLFLKPVEPNAATNLTVITDKRTYYFKLTSSKSQAAMTFLVRFVYPNSNVK
TYAGAGSSQRMSNGFDPAKLNLGYGTSGNKTAIPLKRAFDDGQFTYFMFDQNAEIPSVYTVGPDGTETIV
NTRREGQYLVVERTASLFTLRNGNSHLCVQNNANPYKRAVSGPVSTVGGN
 
Nucleotide Sequence: 783 bp     [Download]
>gi|21264228|ref|NC_003922.1|:c37005-36223 Xanthomonas axonopodis pv. citri str. 306 plasmid pXAC64, complete sequence
ATGAAATTCAACCCTGTTCCTCTCGCTGTTGCCCTTATTGCGGGCACGTCGATTTCGCTGGCGTGGGTGC
CGGCTCACGCGGCGAAGTTGCCGCATTCCTTGGTGACGGATGATCGTGTCAAGCAAGTGCCGTATGACCC
GAATCAGGTCTACGAGATCGTCGGCACGTATGGTTATCAGACCTCTATCGAGTTCGCCAATGACGAAACG
GTCAAAGTTGTCACGTTGGGCGATTCGATTGCATGGCAAACCGTGCCGTACCAGAACCGCCTTTTCCTCA
AGCCGGTGGAGCCGAACGCGGCCACGAACCTGACCGTGATTACCGATAAGCGCACGTACTACTTCAAGCT
GACTAGCTCGAAGAGCCAAGCGGCGATGACGTTCCTTGTCCGCTTCGTCTATCCGAACTCGAACGTGAAG
ACATACGCCGGCGCGGGCAGCTCGCAGCGCATGAGCAACGGGTTCGATCCTGCCAAGCTCAACCTTGGCT
ACGGCACGTCGGGAAACAAGACGGCCATCCCGTTGAAGCGGGCTTTCGATGATGGCCAGTTCACCTATTT
CATGTTCGACCAGAACGCAGAAATCCCTTCGGTGTACACCGTTGGCCCCGACGGCACAGAGACCATCGTC
AACACGCGACGCGAGGGGCAATACCTTGTGGTTGAACGCACGGCAAGCCTGTTCACGCTGCGCAATGGCA
ACTCCCACCTCTGCGTGCAGAACAACGCCAATCCCTACAAGCGCGCTGTGAGTGGCCCGGTGAGCACTGT
CGGGGGTAACTGA
 Primer design