SecReT4
Protein ID: 21264268
T4SS name [ID]VirB [361]
Gene symbolvirB8
Locus tagXACb0040
StrainXanthomonas axonopodis pv. citri str. 306
Repliconplasmid pXAC64 [GenBank: NC_003922] [Browse all T4SS(s) in this replicon]
Location [Strand]37030..37704 [-]
ProductVirB8 protein
Component typeVirB8
UniProt IDQ8PRJ2
KEGG IDxac:XACb0040
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.3e-41, Aligned region: 23..220
Protein Sequence: 224 a.a.     [Download]
>gi|21264268|ref|NP_644768.1| VirB8 protein [Xanthomonas axonopodis pv. citri str. 306]
MKFGKKTFLGDKETQSAQLGGSNKLKQERNRAYLLIGLLLFVVGGMASAVTVLANIHTVIPVVSVIDANG
HVVKQQVVNKEAITGQESFVQSQVYDFIMYCNTFDPDWRQHFADLCRLHSTQTVAGQYDAETSPDNPNNP
YYQLGQGGRRYPKITGITSLGKDAYQVSFQSITEKAGSPPKTDYYTALVRYTFTFKPLALGDRWENALGY
ATTAYRKDQELSRQ
 
Nucleotide Sequence: 675 bp     [Download]
>gi|21264228|ref|NC_003922.1|:c37704-37030 Xanthomonas axonopodis pv. citri str. 306 plasmid pXAC64, complete sequence
ATGAAATTCGGCAAGAAAACTTTTTTGGGCGACAAAGAGACGCAGTCGGCCCAATTGGGCGGCTCGAACA
AGCTCAAACAGGAACGTAACCGCGCGTATCTGCTCATCGGGTTGCTGCTGTTCGTCGTCGGCGGCATGGC
GAGTGCGGTCACGGTGCTCGCCAACATTCACACGGTCATTCCAGTGGTGTCGGTCATTGACGCGAACGGG
CACGTGGTGAAACAGCAGGTGGTCAACAAGGAAGCGATCACGGGGCAGGAAAGCTTCGTCCAGAGCCAGG
TGTACGACTTCATCATGTACTGCAACACGTTCGACCCGGACTGGCGGCAGCACTTTGCCGACCTCTGCCG
GCTGCACTCGACACAAACGGTAGCAGGCCAGTACGACGCGGAAACCAGCCCCGATAACCCGAACAATCCG
TATTACCAGCTCGGGCAGGGCGGCCGGCGTTACCCGAAGATCACGGGCATTACGTCGCTAGGCAAGGACG
CCTATCAGGTGTCGTTCCAGTCGATTACAGAGAAGGCAGGCAGTCCGCCGAAGACGGACTACTACACCGC
GCTCGTTCGCTACACCTTCACCTTCAAGCCGCTCGCCCTGGGCGACCGGTGGGAAAACGCATTGGGCTAC
GCGACGACGGCATACCGCAAAGATCAAGAGTTGAGCCGCCAGTAA
 Primer design