SecReT4
Protein ID: 21264269
T4SS name [ID]VirB [361]
Gene symbolvirB6
Locus tagXACb0041
StrainXanthomonas axonopodis pv. citri str. 306
Repliconplasmid pXAC64 [GenBank: NC_003922] [Browse all T4SS(s) in this replicon]
Location [Strand]37701..38567 [-]
ProductVirB6 protein
Component typeVirB6
UniProt IDQ8PRJ1
KEGG IDxac:XACb0041
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.8e-44, Aligned region: 41..263
Protein Sequence: 288 a.a.     [Download]
>gi|21264269|ref|NP_644769.1| VirB6 protein [Xanthomonas axonopodis pv. citri str. 306]
MANMTLQGLLGAADGVTQSFLSQTYPAIAGAISTPITYAAMLYWALHGYKVYAGHSPMQWKDLLAKTVMT
VAVFGTLNWGGLAQKLYNAFVSFMEGAAATIMAGKPTSQMLDALYSNVGKVSDTLRSADSYQIGMILDGL
VLFVLNCILFVLALAYMTIAKFGLAITMVLCPLFLCFLMFPETRQWFMNWVSKMLTFCFMYILVIAIVRF
GFLAFGDAIDEAGKAAQAASPDLVTSEQTAQLVIVEGVLILFMLGVRGWASALSGGASSSTGTLVMIARM
VMTKGAGK
 
Nucleotide Sequence: 867 bp     [Download]
>gi|21264228|ref|NC_003922.1|:c38567-37701 Xanthomonas axonopodis pv. citri str. 306 plasmid pXAC64, complete sequence
ATGGCCAACATGACGCTACAGGGCTTGCTCGGTGCTGCCGATGGCGTTACCCAGTCGTTCCTATCGCAGA
CGTACCCGGCCATCGCAGGGGCAATCTCGACGCCGATCACCTACGCGGCCATGCTCTATTGGGCGCTGCA
TGGCTACAAGGTCTATGCCGGGCACTCCCCTATGCAGTGGAAAGACCTCTTGGCGAAGACCGTCATGACG
GTGGCCGTATTTGGAACGCTCAATTGGGGTGGGCTGGCTCAGAAGCTCTACAACGCCTTCGTGTCGTTTA
TGGAAGGCGCGGCCGCCACGATCATGGCCGGCAAGCCTACATCGCAGATGCTCGATGCGCTGTATAGCAA
CGTCGGAAAGGTCTCGGACACGTTGCGGTCGGCGGACTCTTACCAGATAGGGATGATCCTTGATGGTCTG
GTGTTGTTTGTCCTGAACTGCATCTTGTTCGTGCTCGCCCTTGCGTACATGACCATCGCCAAGTTCGGCT
TGGCTATCACGATGGTGCTCTGCCCGCTGTTTCTCTGCTTCCTGATGTTCCCTGAAACGCGACAGTGGTT
CATGAATTGGGTGAGCAAGATGCTGACTTTCTGTTTCATGTACATCCTCGTGATTGCCATCGTCCGCTTT
GGCTTTCTGGCCTTCGGTGACGCTATCGATGAGGCAGGGAAAGCGGCACAAGCTGCATCGCCCGACCTTG
TGACGTCTGAGCAAACTGCGCAGCTCGTCATCGTGGAAGGCGTGTTGATTCTGTTCATGTTGGGTGTCCG
CGGTTGGGCGTCGGCGTTGTCGGGTGGTGCCTCGTCGTCTACCGGCACGCTGGTGATGATCGCTCGCATG
GTAATGACCAAGGGAGCTGGCAAATGA
 Primer design