SecReT4
Protein ID: 21264272
T4SS name [ID]VirB [361]
Gene symbolvirB5
Locus tagXACb0044
StrainXanthomonas axonopodis pv. citri str. 306
Repliconplasmid pXAC64 [GenBank: NC_003922] [Browse all T4SS(s) in this replicon]
Location [Strand]39202..39864 [-]
ProductVirB5 protein
Component typeVirB5
UniProt IDQ8PRI8
KEGG IDxac:XACb0044
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 3.1e-43, Aligned region: 24..208
Protein Sequence: 220 a.a.     [Download]
>gi|21264272|ref|NP_644772.1| VirB5 protein [Xanthomonas axonopodis pv. citri str. 306]
MKKPLVALAVAASLGASVPTFATGMPTFDAAAVLQLQQQFQQLQEQYKTLKDQYAAVTGSYGRGQIGLGD
SINAASVVPGSWQEVVAQQQSGAFGSKQAAYEKLINTMPQDLFANPQAQNATTYKMSTDAVRAALAGGDS
LYAEVQTHLNNLARMSQQVDATVNIKDAQDLQNRIAGENGMMQSAMAKLNAMNMNLQANMVNQQNQATAA
TQKYFRRTGQ
 
Nucleotide Sequence: 663 bp     [Download]
>gi|21264228|ref|NC_003922.1|:c39864-39202 Xanthomonas axonopodis pv. citri str. 306 plasmid pXAC64, complete sequence
ATGAAAAAACCCCTCGTAGCCCTCGCGGTGGCCGCTTCTCTCGGCGCTTCGGTGCCCACCTTCGCTACCG
GCATGCCGACGTTCGACGCGGCGGCGGTGTTGCAGTTGCAACAGCAGTTCCAGCAGTTGCAGGAGCAATA
CAAAACACTCAAGGACCAGTACGCCGCTGTTACGGGCAGCTATGGCCGTGGGCAAATCGGCCTGGGCGAT
TCCATCAACGCGGCATCGGTGGTGCCCGGTTCGTGGCAGGAGGTCGTCGCGCAGCAACAGAGTGGGGCGT
TCGGGTCGAAGCAGGCCGCCTACGAGAAGCTCATCAACACGATGCCGCAAGACCTGTTCGCCAATCCCCA
GGCGCAGAACGCCACGACATACAAGATGAGCACCGATGCGGTGCGGGCTGCGCTTGCAGGTGGTGACTCG
TTGTATGCCGAAGTGCAAACACACCTCAACAATCTGGCGCGCATGAGCCAGCAGGTCGATGCGACGGTGA
ACATCAAGGACGCTCAGGACTTGCAGAACCGCATTGCGGGCGAGAACGGAATGATGCAAAGCGCGATGGC
CAAGCTCAACGCGATGAACATGAACTTGCAAGCGAACATGGTGAACCAGCAGAACCAAGCGACGGCCGCG
ACGCAGAAGTATTTCCGCCGCACCGGCCAATAA
 Primer design