SecReT4
Protein ID: 21264273
T4SS name [ID]VirB [361]
Gene symbolvirB4
Locus tagXACb0045
StrainXanthomonas axonopodis pv. citri str. 306
Repliconplasmid pXAC64 [GenBank: NC_003922] [Browse all T4SS(s) in this replicon]
Location [Strand]39867..42500 [-]
ProductVirB4 protein
Component typeVirB4
UniProt IDQ8PRI7
KEGG IDxac:XACb0045
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 2.2e-21, Aligned region: 242..447
AAA_10 [PF12846], Evalue: 1.4e-13, Aligned region: 510..791
Protein Sequence: 877 a.a.     [Download]
>gi|21264273|ref|NP_644773.1| VirB4 protein [Xanthomonas axonopodis pv. citri str. 306]
MSLSMPVPEGADAAAKEMALSDMIPYTVHYDDESVITKDDGLVQVIKLDGLYFESLTAEQIKQFERRRNT
VLRSIANSDRGVYVHLIRRKVNLYPAGEGGTWFARRFNQAWRERYNKRSFYVNEIYISIVRNRFRQGAPG
ILDRAFSLVSGSKITKEDLESFEEQAKDVNEAANLVVQTLSGYGARKLRIQRRPEFVLDRVSRADAQVAV
ERFKMSWQEFQRSHGHHEVYSRDEVLDYLGEDFSEIGGFLHYLVNLEDERVPVTEMQLDRTLAVSYLDFK
MLSNMMAVQNLSGTRAGAMLSMAEWPARTPSRMLDEFLKQPVEYIITQSFFFTDRISAEHDMRQERRRIA
VNDREGVAEEDKDEITKGLQDLTRGRSVNGLHHLTMLVHVPATTQFADPIENKRQTIADLDGAVGLLKKA
FVNLGVKPVREWFAMETFFWAQLPGQAQHFMGRRGKIKSGNFAGFASLHNFAVGKIDGNLWGPAIMPFET
ESGTAYYFSFHREMEGMVAGHTAFTADTGAGKTTLLAALIAMGDKAYPRVFWFDNREGAKVFMCAMGGQH
TTLTVQGSTGWNPMKLPDTPENRAYLVELLTLMRTCYGGKIVPDDIDRFKKAVHENYALAYPDRRLLNVA
WCFGQGELAKDMRVWHGANGIEGANWGVFDNEHDNIDLTNCRHYCYEMRQLIKDGTARPELPVVLSYPFH
RIEQSMNGEPFILVLEEGQNLVKHAYWREKIDSYIMQIRRKNGLLVFVTPDAKYLYCETDSIQKQTATKI
YLPNGEAKRTDLVDVLGLTPAEYEFVRDTPPENRTFLIRRGNESIKAKFDLSDMPEFIPVLSSNDKGVAL
MEEIIRELETDDPEQWVPVFMERALAKNTHNLKQKGA
 
Nucleotide Sequence: 2634 bp     [Download]
>gi|21264228|ref|NC_003922.1|:c42500-39867 Xanthomonas axonopodis pv. citri str. 306 plasmid pXAC64, complete sequence
ATGTCGCTGTCGATGCCGGTGCCGGAAGGTGCCGACGCCGCCGCCAAGGAAATGGCCCTGAGCGACATGA
TCCCGTACACCGTTCACTACGACGACGAATCGGTCATCACCAAGGATGACGGTCTGGTGCAGGTCATCAA
GCTCGATGGCCTGTACTTCGAGTCGTTGACTGCCGAGCAAATCAAGCAGTTCGAGCGCCGGCGCAACACG
GTGTTGCGCTCCATCGCCAACAGCGACCGGGGCGTCTATGTCCACCTGATCCGCCGCAAGGTGAACCTGT
ATCCGGCAGGAGAGGGCGGCACATGGTTCGCACGGCGCTTCAATCAGGCGTGGCGCGAGCGCTATAACAA
GCGCTCGTTCTACGTGAACGAAATCTATATCTCCATCGTCCGCAATCGCTTCCGGCAAGGTGCGCCCGGC
ATCCTGGATCGCGCGTTCTCATTGGTGTCCGGCTCCAAGATTACGAAAGAGGACCTCGAATCGTTCGAGG
AACAGGCAAAAGACGTCAACGAAGCCGCTAACCTCGTCGTTCAAACCTTGTCGGGCTACGGTGCTCGCAA
GCTGCGCATCCAGCGGCGGCCGGAATTCGTTCTCGACAGGGTAAGCCGTGCTGATGCGCAGGTTGCCGTC
GAGCGATTCAAGATGAGCTGGCAAGAATTCCAACGCTCGCACGGTCATCACGAGGTGTATAGCCGCGACG
AAGTGCTCGACTATCTCGGTGAGGATTTCAGCGAGATTGGTGGTTTCCTGCACTACCTGGTCAATCTGGA
AGATGAACGCGTGCCGGTTACGGAGATGCAGCTAGACCGCACGCTCGCGGTGTCGTACCTCGACTTCAAG
ATGCTCAGCAACATGATGGCCGTCCAGAACCTGAGCGGTACGCGGGCCGGGGCCATGCTGAGCATGGCCG
AGTGGCCGGCTCGCACGCCGTCGCGGATGCTTGACGAATTTCTCAAGCAGCCGGTGGAGTACATCATCAC
GCAGTCGTTTTTCTTTACCGACCGGATCAGCGCTGAGCACGACATGCGGCAGGAGCGCCGACGCATTGCG
GTCAATGACCGTGAGGGCGTGGCGGAAGAGGACAAGGACGAGATTACCAAGGGCCTGCAAGACTTGACGC
GCGGCCGCTCGGTCAACGGTCTGCATCACCTGACCATGCTCGTGCATGTGCCGGCCACGACGCAATTTGC
CGACCCTATCGAAAACAAGCGGCAGACGATTGCCGATCTCGATGGCGCGGTCGGGCTGCTGAAGAAAGCG
TTCGTGAATCTCGGCGTCAAGCCGGTTCGCGAGTGGTTCGCGATGGAGACATTCTTCTGGGCGCAGCTTC
CCGGCCAGGCGCAGCACTTCATGGGCCGGCGCGGCAAGATCAAGTCGGGCAACTTCGCCGGCTTCGCCTC
GTTGCACAACTTCGCAGTCGGCAAGATCGACGGCAACCTGTGGGGGCCGGCCATCATGCCTTTCGAGACG
GAGAGCGGCACCGCCTACTACTTCAGCTTCCATCGTGAAATGGAAGGGATGGTCGCCGGCCACACGGCGT
TCACGGCGGACACCGGCGCGGGCAAGACAACTCTGTTGGCCGCGTTGATCGCGATGGGTGACAAGGCCTA
CCCACGTGTGTTCTGGTTCGATAACCGCGAAGGCGCGAAGGTGTTCATGTGCGCAATGGGCGGCCAGCAC
ACGACGCTGACCGTGCAGGGCAGTACGGGCTGGAATCCGATGAAGCTGCCCGACACGCCGGAGAACCGCG
CCTATCTGGTCGAACTGCTCACGCTGATGCGGACATGCTACGGCGGCAAGATCGTGCCTGACGACATTGA
TCGGTTCAAGAAGGCTGTCCACGAGAACTACGCGCTGGCCTATCCAGATCGCCGCCTGCTCAATGTGGCG
TGGTGTTTCGGCCAAGGCGAGTTGGCGAAGGACATGCGGGTATGGCACGGAGCCAACGGCATTGAGGGTG
CGAACTGGGGCGTGTTCGACAACGAACACGACAACATCGACCTGACCAATTGCCGGCACTATTGCTACGA
GATGCGGCAGCTCATCAAGGACGGCACGGCTCGGCCTGAGCTGCCGGTGGTGTTGAGCTACCCATTCCAT
CGCATCGAGCAGTCCATGAACGGCGAGCCGTTCATCCTCGTGCTGGAAGAAGGGCAGAACCTCGTCAAGC
ACGCGTATTGGCGCGAAAAGATTGACAGCTACATCATGCAGATTCGCCGCAAGAACGGCCTGCTGGTCTT
TGTCACGCCGGATGCCAAGTACCTCTACTGCGAAACCGATTCGATCCAGAAGCAGACGGCAACGAAGATC
TATTTGCCGAACGGCGAAGCCAAGCGCACGGACCTTGTTGATGTGCTCGGCCTGACACCGGCTGAGTACG
AATTCGTGCGCGACACCCCTCCCGAGAACCGGACGTTCCTGATTCGACGCGGTAATGAGTCGATCAAGGC
GAAGTTCGATCTCTCCGATATGCCCGAGTTCATCCCTGTGCTGTCCTCGAACGACAAGGGCGTGGCGCTC
ATGGAGGAAATCATTCGTGAGCTGGAAACCGACGATCCCGAACAGTGGGTGCCGGTGTTTATGGAGCGTG
CGCTCGCCAAGAACACGCACAACCTCAAGCAGAAAGGAGCATGA
 Primer design