SecReT4
Protein ID: 21264274
T4SS name [ID]VirB [361]
Gene symbolvirB3
Locus tagXACb0046
StrainXanthomonas axonopodis pv. citri str. 306
Repliconplasmid pXAC64 [GenBank: NC_003922] [Browse all T4SS(s) in this replicon]
Location [Strand]42523..42822 [-]
ProductVirB3 protein
Component typeVirB3
UniProt IDQ8PRI6
KEGG IDxac:XACb0046
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 6.6e-16, Aligned region: 1..92
Protein Sequence: 99 a.a.     [Download]
>gi|21264274|ref|NP_644774.1| VirB3 protein [Xanthomonas axonopodis pv. citri str. 306]
MSADEQFHDEGESLVAAMTRPTMVGGLTLASLAMSFYFPGMAALITRSLWAAALIPVLLLISYLVCLKDV
YLFDIMSAATHLKTCPNKRFWGCRRYAPR
 
Nucleotide Sequence: 300 bp     [Download]
>gi|21264228|ref|NC_003922.1|:c42822-42523 Xanthomonas axonopodis pv. citri str. 306 plasmid pXAC64, complete sequence
ATGAGTGCCGACGAGCAATTCCACGATGAAGGGGAGTCGCTCGTCGCTGCGATGACCCGCCCCACAATGG
TGGGCGGGTTGACGCTGGCAAGTCTTGCGATGAGCTTTTATTTCCCCGGCATGGCCGCGTTAATCACGCG
ATCACTTTGGGCTGCGGCATTGATTCCAGTCTTACTGCTGATTAGTTATCTGGTCTGCCTGAAAGACGTG
TACCTGTTCGACATCATGTCGGCCGCAACCCATTTGAAAACGTGTCCGAACAAACGTTTTTGGGGATGCC
GACGCTATGCGCCTCGTTGA
 Primer design