SecReT4
Protein ID: 21264275
T4SS name [ID]VirB [361]
Gene symbolvirB2
Locus tagXACb0047
StrainXanthomonas axonopodis pv. citri str. 306
Repliconplasmid pXAC64 [GenBank: NC_003922] [Browse all T4SS(s) in this replicon]
Location [Strand]42819..43196 [-]
ProductVirB2 protein
Component typeVirB2
UniProt IDQ8PRI5
KEGG IDxac:XACb0047
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.4e-20, Aligned region: 25..115
Protein Sequence: 125 a.a.     [Download]
>gi|21264275|ref|NP_644775.1| VirB2 protein [Xanthomonas axonopodis pv. citri str. 306]
MEKNEAIEKDTTAGPRKGDKVDRVLDLAANVLVMALVFLPQLAYAQDVGGTFGGITAFLKSITQLLIYEW
GYYIGIITLAIQGYRWKSGRIDLMTLGGWGLGIGLVFFAPNIVSDLKARSSGSIQ
 
Nucleotide Sequence: 378 bp     [Download]
>gi|21264228|ref|NC_003922.1|:c43196-42819 Xanthomonas axonopodis pv. citri str. 306 plasmid pXAC64, complete sequence
GTGGAAAAGAATGAAGCGATTGAAAAGGACACGACAGCAGGCCCGCGCAAGGGCGACAAGGTAGACAGGG
TGCTCGATCTGGCGGCTAACGTCCTCGTGATGGCCCTCGTCTTTCTTCCGCAGCTCGCATATGCACAAGA
CGTCGGTGGCACGTTCGGCGGGATCACCGCCTTCCTGAAGTCGATCACGCAACTGCTCATTTATGAGTGG
GGCTACTACATCGGCATCATCACCTTGGCGATCCAAGGGTATCGTTGGAAGTCGGGCCGCATCGACCTGA
TGACGCTCGGCGGTTGGGGCCTCGGTATCGGCCTCGTGTTCTTCGCGCCAAATATCGTTTCCGACCTCAA
GGCGCGTTCCTCCGGTTCGATCCAATGA
 Primer design