SecReT4
Protein ID: 21492796
T4SS name [ID]VirB [219]
Gene symbol-
Locus tagRHE_PD00167
StrainRhizobium etli CFN 42
Repliconplasmid symbiotic plasmid p42d [GenBank: NC_004041] [Browse all T4SS(s) in this replicon]
Location [Strand]180067..181986 [-]
Productconjugal transfer coupling protein TraG
Component typeVirD4
UniProt IDQ8KL68
KEGG IDret:RHE_PD00167
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 4.8e-96, Aligned region: 171..634
TraG-D_C [PF12696], Evalue: 2.7e-30, Aligned region: 473..596
TrwB_AAD_bind [PF10412], Evalue: 7e-22, Aligned region: 432..612
Protein Sequence: 639 a.a.     [Download]
>gi|21492796|ref|NP_659871.1| conjugal transfer coupling protein TraG [Rhizobium etli CFN 42]
MGLRGKPHPSLLLVLAPIAVTTITIYIVGWRWPGLAVGMSGRMEYWFLRAAPVLPLMFGPLAGLLTVWAL
PLHRRRPVAMASLLCFLGIAAYYALREFGRLAPTVQARVVPWDRALSYLDMVAVIAAVAGFMSVAVSARI
SVVVPDEIKRARRGIFGDADWLPMAAAGKLFPPDGEIVVGERYRVDKEIIHALPFDVNDRSTWGQGGKAP
LLTYRQDFDSTHMLFFAGSGGYKTTSNVVPTALIYTGPMICLDPSTEVAPMVVEHRTNALGREVMVLDPT
NPIMGFNVLDGIEASKQKEEDIVGIAHMLLSESLRFESSTGSYFQNQAHNLLTGLLAHVMLSPEYEGRRS
LRSLRQIVSEPEPSVLAMLRDIQEHSGSAFIRETLGVFTNMTEQTFSGVYSTASKDTQWLSLDSYAALVC
GNAFKSSDIVSGKKDVFLNISASILRSYPGIARVIIGSLINAMVQADGAFQRRALFMLDEVDLLGYMRVL
EEARDRGRKYGISMMLMYQSVGQLERHFGKDGATSWIDGCAFASYAAIKALDTARNLSAQCGEMTVEVKG
SSRNIGWDTKNNASRRSENVNFQRRPLIMPHEITQSMRKDEQIIIVQGHSPIRCGRAIYFRRKEMDQAAK
VNRFVKPVL
 
Nucleotide Sequence: 1920 bp     [Download]
>gi|89255298|ref|NC_004041.2|:c181986-180067 Rhizobium etli CFN 42 symbiotic plasmid p42d, complete sequence
ATGGGCCTAAGAGGGAAACCGCATCCGAGCCTGCTGCTCGTTTTGGCGCCGATCGCCGTCACCACGATCA
CAATCTACATTGTTGGCTGGCGGTGGCCAGGGCTCGCCGTCGGCATGTCGGGAAGGATGGAATATTGGTT
CCTGCGGGCAGCACCTGTACTGCCTCTAATGTTCGGACCTCTTGCCGGACTTCTGACAGTTTGGGCCCTG
CCGCTGCATCGGCGAAGGCCGGTCGCCATGGCAAGTCTTTTGTGTTTTCTCGGCATTGCCGCCTACTATG
CGCTACGCGAATTCGGCCGGCTTGCACCGACTGTGCAGGCCCGGGTCGTTCCGTGGGATCGAGCGCTGTC
CTATCTTGATATGGTCGCAGTCATTGCTGCCGTCGCCGGCTTCATGTCAGTGGCGGTGTCAGCCCGCATC
TCCGTCGTCGTGCCAGATGAAATCAAGCGTGCCCGGCGTGGAATATTTGGAGATGCCGATTGGCTGCCGA
TGGCGGCAGCAGGAAAGCTGTTCCCGCCGGATGGGGAAATCGTGGTCGGCGAGCGTTATCGGGTCGACAA
GGAAATCATCCATGCGCTTCCCTTCGATGTAAACGATCGCAGCACATGGGGACAGGGCGGGAAGGCGCCA
TTGCTCACCTACAGACAGGACTTCGATTCCACCCATATGCTGTTTTTCGCGGGATCGGGCGGATACAAAA
CGACCAGCAACGTCGTGCCGACGGCGCTCATATATACCGGACCCATGATCTGCCTCGATCCTTCCACTGA
GGTCGCGCCCATGGTCGTCGAGCACCGCACCAATGCGCTCGGGCGCGAGGTCATGGTGCTCGATCCGACG
AACCCGATCATGGGCTTCAACGTGCTCGACGGGATCGAAGCATCCAAGCAAAAGGAAGAGGACATCGTCG
GCATTGCCCATATGCTGCTGTCGGAAAGCCTTCGCTTCGAAAGCTCGACGGGATCCTACTTCCAGAACCA
GGCGCACAACCTCCTGACCGGTCTGCTCGCCCATGTGATGCTCTCGCCCGAATATGAGGGCCGGCGAAGC
TTGCGCAGTCTCCGCCAGATCGTTTCCGAACCGGAGCCCTCGGTGCTCGCTATGCTGCGCGACATTCAGG
AGCATTCCGGTTCGGCCTTCATCCGCGAAACGCTCGGCGTCTTCACCAACATGACCGAGCAGACGTTTTC
GGGCGTCTATTCCACAGCATCGAAGGATACCCAGTGGCTGTCGCTCGACAGCTATGCCGCGCTCGTCTGC
GGCAATGCCTTCAAATCGAGTGATATCGTTTCGGGCAAGAAGGACGTCTTCCTCAACATCTCCGCATCGA
TCTTGCGCTCCTATCCGGGCATCGCTCGTGTGATCATCGGCTCGCTCATCAACGCCATGGTGCAGGCCGA
CGGCGCCTTCCAGCGCCGGGCGCTGTTCATGCTCGATGAGGTCGATCTGCTCGGCTACATGAGGGTGCTC
GAGGAGGCGCGCGACCGCGGCCGCAAGTACGGCATCTCGATGATGTTGATGTACCAGTCGGTCGGGCAGT
TGGAGCGGCATTTCGGGAAGGATGGCGCGACGTCATGGATCGATGGCTGCGCTTTCGCCTCTTACGCAGC
GATCAAGGCGCTCGACACGGCGCGCAACCTCTCTGCGCAATGTGGCGAGATGACGGTGGAGGTGAAGGGC
AGTTCCCGCAACATCGGCTGGGACACGAAGAACAATGCATCCAGGAGATCCGAGAACGTCAACTTCCAGC
GCCGGCCGCTGATCATGCCGCACGAGATCACCCAGTCGATGAGGAAGGACGAGCAGATCATCATCGTCCA
GGGGCATAGTCCGATCCGCTGCGGCCGGGCGATCTACTTCCGGCGAAAGGAGATGGATCAGGCAGCGAAG
GTCAATCGTTTCGTCAAACCGGTGCTATGA
 Primer design