SecReT4
Protein ID: 21492809
T4SS name [ID]VirB [219]
Gene symbol-
Locus tagRHE_PD00153
StrainRhizobium etli CFN 42
Repliconplasmid symbiotic plasmid p42d [GenBank: NC_004041] [Browse all T4SS(s) in this replicon]
Location [Strand]170474..171502 [+]
Producttransport secretion system IV, VirB11 protein
Component typeVirB11
UniProt IDQ8KIN5
KEGG IDret:RHE_PD00153
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.1e-85, Aligned region: 15..316
AAA_17 [PF13207], Evalue: 5.1e-05, Aligned region: 166..198
AAA_18 [PF13238], Evalue: 6.4e-05, Aligned region: 166..209
Protein Sequence: 342 a.a.     [Download]
>gi|21492809|ref|NP_659884.1| transport secretion system IV, VirB11 protein [Rhizobium etli CFN 42]
MTEAADAGVVRELLSPLSRFLRDKTLYEVIVNRPGQVVTEGREGWQTYEMPELSFDRLMRLARSVASFSN
QSIDETRPILSATLPDDERIQIVIPPATTKGTVSITIRKPSSVSLTLEDLDHGGLFADVLPAQDDGRRSD
HRLLEYYRIGAYKAFLREAVFARKNIIISGATGSGKTTLSKALIRHIPQSERIISIEDTPELVVPQPNHV
RLFYSKGGQGLAKVGAKDLLESCLRMRPDRILLQELRDGTAFYYIRNVNSGHPGSITTVHADSARLAFEQ
LTLLVKESEGGGDLERHDIREMLTIAVDVIVQCKRIDGRFRVSEIYYRDAATDLGRSSSDRA
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|89255298|ref|NC_004041.2|:170474-171502 Rhizobium etli CFN 42 symbiotic plasmid p42d, complete sequence
ATGACTGAAGCTGCCGACGCCGGCGTCGTGCGCGAACTGCTTTCGCCACTATCACGCTTCCTGCGCGACA
AGACGCTCTATGAGGTCATCGTCAACCGGCCGGGACAGGTCGTCACGGAGGGGAGGGAGGGATGGCAGAC
CTATGAGATGCCCGAACTCTCTTTCGACAGGTTGATGCGTCTCGCCCGCTCGGTCGCGAGCTTCTCCAAT
CAGTCGATCGACGAGACGCGACCGATCCTGTCGGCGACCTTGCCGGACGATGAGCGGATCCAGATCGTCA
TCCCGCCGGCAACGACGAAGGGAACCGTGAGCATCACCATCCGCAAGCCGTCCTCCGTGTCGCTGACCCT
CGAGGATCTCGATCATGGGGGATTGTTCGCCGATGTCTTGCCGGCCCAAGATGACGGGAGACGATCAGAC
CACAGGCTGTTGGAATACTATCGCATCGGCGCCTACAAGGCGTTTCTCCGGGAGGCGGTGTTTGCAAGAA
AGAACATCATCATCTCCGGCGCCACCGGGTCGGGAAAAACAACTCTATCGAAAGCGCTGATCCGCCACAT
TCCGCAAAGCGAGCGGATTATTTCGATCGAAGACACTCCCGAGCTGGTGGTCCCGCAACCCAACCATGTT
CGGCTCTTCTATTCCAAAGGCGGTCAGGGCCTGGCGAAGGTCGGCGCGAAGGACCTGCTCGAATCCTGCC
TGCGCATGCGGCCCGACCGCATCCTGCTGCAGGAATTGCGAGACGGAACCGCCTTCTACTACATCCGCAA
CGTCAACTCCGGCCATCCTGGCTCCATCACCACGGTCCATGCCGATTCCGCCCGCCTCGCCTTCGAGCAG
CTGACATTGCTGGTCAAGGAGTCGGAGGGCGGCGGGGACCTCGAACGGCACGACATCCGCGAGATGTTGA
CGATCGCGGTCGACGTCATCGTCCAATGCAAGCGGATCGACGGGCGGTTTCGGGTGAGTGAGATCTACTA
TCGAGATGCCGCGACTGACCTCGGCCGCTCTTCGTCGGATCGAGCTTAA
 Primer design