SecReT4
Protein ID: 21492813
T4SS name [ID]VirB [219]
Gene symbol-
Locus tagRHE_PD00149
StrainRhizobium etli CFN 42
Repliconplasmid symbiotic plasmid p42d [GenBank: NC_004041] [Browse all T4SS(s) in this replicon]
Location [Strand]167473..167754 [+]
Producttransport secretion system IV, VirB7 protein
Component typeVirB7
UniProt IDQ8KIN1
KEGG IDret:RHE_PD00149
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 93 a.a.     [Download]
>gi|21492813|ref|NP_659888.1| transport secretion system IV, VirB7 protein [Rhizobium etli CFN 42]
MLRIVLSFLLTAGLVGCGSISHSLPKCDGYSRRPLNRAMWQWQGSGGEQPATGAVPAEPTTHAASYVAEP
SSARPAAFAHFHVAGSYRPCEGE
 
Nucleotide Sequence: 282 bp     [Download]
>gi|89255298|ref|NC_004041.2|:167473-167754 Rhizobium etli CFN 42 symbiotic plasmid p42d, complete sequence
ATGCTCCGTATCGTTTTATCGTTTTTGCTGACCGCCGGTCTCGTAGGCTGCGGTTCGATTTCCCACTCGT
TGCCCAAATGTGATGGTTATTCCCGCCGGCCGCTGAACCGCGCCATGTGGCAATGGCAGGGCAGTGGAGG
CGAGCAGCCGGCGACCGGGGCTGTTCCCGCAGAGCCGACCACTCACGCTGCCTCCTATGTGGCGGAACCA
TCTTCAGCCAGACCAGCCGCTTTCGCGCATTTCCATGTCGCGGGCTCCTACCGTCCATGCGAGGGCGAGT
GA
 Primer design