SecReT4
Protein ID: 215276221
T4SS name [ID]Tra_F [90]
Gene symboltraX
Locus tagE2348_P1_041
StrainEscherichia coli O127:H6 str. E2348/69
Repliconplasmid pMAR2 [GenBank: NC_011603] [Browse all T4SS(s) in this replicon]
Location [Strand]36134..36880 [-]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDB7UTI7
KEGG IDecg:E2348_P1_041
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 4.1e-52, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|215276221|ref|YP_002332184.1| conjugal transfer pilus acetylation protein TraX [Escherichia coli O127:H6 str. E2348/69]
MTTDNTNTTRNDSLAARTDTWLQSLLVWSPGQRDIIKTVALVLMVLDHANRILHLDQSWMFLVGRGAFPL
FALVWGLNLSRHTHIRQEAINRLWGWAVIAQFAYYLAGFPWYEGNILFAFAVAAQVLTWCETRTWWRSAE
TMLLLAMWLPFSGTSYGIAGLLMLAVSHRLYRAEDRMERLALVACLLAVIPALNLATSDAAAVAGLVMTV
LTVGLVSCTGKSLPRFWYGDFFPTFYACHLTVLGVLAV
 
Nucleotide Sequence: 747 bp     [Download]
>gi|215276192|ref|NC_011603.1|:c36880-36134 Escherichia coli O127:H6 str. E2348/69 plasmid pMAR2, complete sequence
ATGACAACGGATAACACGAACACAACACGTAATGATTCACTGGCTGCCCGGACCGATACCTGGTTGCAGT
CGTTGCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCACTGGTGCTGATGGTTCTGGA
CCATGCAAACCGCATTCTGCATCTGGACCAGTCGTGGATGTTTCTGGTCGGGCGTGGGGCCTTTCCGCTG
TTTGCCCTGGTGTGGGGGCTGAATCTGTCCCGTCATACGCATATCCGGCAGGAGGCCATTAACCGGCTGT
GGGGATGGGCGGTGATTGCCCAGTTCGCATATTATCTGGCCGGCTTTCCCTGGTATGAGGGGAATATCCT
GTTTGCCTTTGCAGTTGCGGCACAGGTGCTGACATGGTGTGAAACGCGCACCTGGTGGCGTTCCGCAGAG
ACCATGTTGCTTCTGGCAATGTGGTTGCCTTTCTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGC
TGGCAGTCAGCCACAGGCTGTACCGGGCGGAAGACAGAATGGAACGTCTGGCGCTGGTCGCCTGCCTGCT
GGCTGTTATTCCGGCGCTTAACCTTGCCACCAGTGATGCAGCGGCGGTGGCCGGCCTTGTGATGACGGTG
CTGACTGTTGGTCTGGTGTCCTGTACAGGGAAATCACTACCCCGTTTCTGGTACGGGGATTTTTTCCCGA
CGTTCTATGCCTGTCATCTTACTGTGCTGGGCGTTCTGGCTGTGTGA
 Primer design