SecReT4
Protein ID: 215276233
T4SS name [ID]Tra_F [90]
Gene symboltraQ
Locus tagE2348_P1_053
StrainEscherichia coli O127:H6 str. E2348/69
Repliconplasmid pMAR2 [GenBank: NC_011603] [Browse all T4SS(s) in this replicon]
Location [Strand]51908..52192 [-]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDB7UTJ9
KEGG IDecg:E2348_P1_053
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 2.4e-50, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|215276233|ref|YP_002332196.1| conjugal transfer pilin chaperone TraQ [Escherichia coli O127:H6 str. E2348/69]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSRE
EREALEARQQAMMAEQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|215276192|ref|NC_011603.1|:c52192-51908 Escherichia coli O127:H6 str. E2348/69 plasmid pMAR2, complete sequence
ATGATAAGTAAACGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGCTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCCCGTGTCAGCCGGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGCAGAGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design