SecReT4
Protein ID: 215276236
T4SS name [ID]Tra_F [90]
Gene symboltraF
Locus tagE2348_P1_056
StrainEscherichia coli O127:H6 str. E2348/69
Repliconplasmid pMAR2 [GenBank: NC_011603] [Browse all T4SS(s) in this replicon]
Location [Strand]52952..53713 [-]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDB7UTK2
KEGG IDecg:E2348_P1_056
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.5e-78, Aligned region: 29..243
Protein Sequence: 253 a.a.     [Download]
>gi|215276236|ref|YP_002332199.1| conjugal pilus assembly protein TraF [Escherichia coli O127:H6 str. E2348/69]
MMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAALQTATKR
ALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSARKAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQR
QAIAKLAEHYGIMFFYRGQDPIDGQLVQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVK
YFPAMMLVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 762 bp     [Download]
>gi|215276192|ref|NC_011603.1|:c53713-52952 Escherichia coli O127:H6 str. E2348/69 plasmid pMAR2, complete sequence
GTGATGAAAGGAATGAAGATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTATTTTTCCGGCGT
CAGGAAAAGATGCAGGCTGGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGAAAATAAACCTGT
ACCTGCAGCCCCCCGTCAGGAACCGGATATTATGCAGAAACTGGCCGCACTGCAGACGGCAACAAAGCGG
GCGCTGTACGAAGCCATTCTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGCTGCAAAATTACT
GGACTCAGCAGGCCGGGCTTTTCACCATGAGCGCCAGAAAGGCCATGCTGGCACATCCTGAACTGGACTA
TAACCTGCAGTACAGCCATTACAACGGCACGGTACGGAACCAGCTGGCAGCAGACCAGGCGCAGCAGCGA
CAGGCCATTGCGAAACTGGCTGAACACTACGGCATCATGTTTTTTTACCGGGGGCAGGACCCCATCGACG
GGCAACTGGTGCAGGTCATTAATGGCTTCCGGGATACGTATGGTCTGAGTGTTATTCCCGTTTCCGTGGA
TGGCGTGATTAATCCGCTGTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGCCTCGGCGTGAAA
TATTTCCCGGCCATGATGCTGGTTGACCCGAAACAGGGCAGTGTTCGCCCGTTATCATACGGCTTTATTT
CGCAGGACGACCTGGCAAAACAGTTCCTGAACGTTTCTGAAGATTTTAAACCCAATTTTTAA
 Primer design