SecReT4
Protein ID: 215276252
T4SS name [ID]Tra_F [90]
Gene symboltraL
Locus tagE2348_P1_072
StrainEscherichia coli O127:H6 str. E2348/69
Repliconplasmid pMAR2 [GenBank: NC_011603] [Browse all T4SS(s) in this replicon]
Location [Strand]65942..66253 [-]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDB7UTL8
KEGG IDecg:E2348_P1_072
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.3e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|215276252|ref|YP_002332215.1| conjugal transfer pilus assembly protein TraL [Escherichia coli O127:H6 str. E2348/69]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGITTSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|215276192|ref|NC_011603.1|:c66253-65942 Escherichia coli O127:H6 str. E2348/69 plasmid pMAR2, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTATTGGCTGGGGTATCACAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design