SecReT4
Protein ID: 215528070
T4SS name [ID]Trw [148]
Gene symboltraN
Locus tagpKP96_041
StrainKlebsiella pneumoniae plasmid pKP96 (NC_011617)
Repliconplasmid pKP96 [GenBank: NC_011617] [Browse all T4SS(s) in this replicon]
Location [Strand]40404..40550 [+]
Productconjugal transfer protein
Component typeTrwH
UniProt IDB6RFP6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 48 a.a.     [Download]
>gi|215528070|ref|YP_002332884.1| conjugal transfer protein [Klebsiella pneumoniae]
MRSLLLMGVLLISACSSGHKPPPEPDWSNTVPVNKTIPVDTQGGANES
 
Nucleotide Sequence: 147 bp     [Download]
>gi|215528069|ref|NC_011617.1|:40404-40550 Klebsiella pneumoniae plasmid pKP96, complete sequence
ATGCGCAGCTTATTGCTTATGGGAGTTCTTCTGATTAGCGCCTGTTCCAGCGGGCATAAACCGCCACCGG
AGCCGGACTGGAGCAACACCGTTCCAGTAAACAAAACAATCCCGGTTGATACGCAAGGTGGTGCAAATGA
AAGCTAA
 Primer design