SecReT4
Protein ID: 215528073
T4SS name [ID]Trw [148]
Gene symboltraC
Locus tagpKP96_038
StrainKlebsiella pneumoniae plasmid pKP96 (NC_011617)
Repliconplasmid pKP96 [GenBank: NC_011617] [Browse all T4SS(s) in this replicon]
Location [Strand]38317..39030 [+]
Productconjugal transfer protein
Component typeTrwJ
UniProt IDB6RFP3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 9.1e-50, Aligned region: 25..216
CENP-Q [PF13094], Evalue: 3.3e-06, Aligned region: 33..137
Protein Sequence: 237 a.a.     [Download]
>gi|215528073|ref|YP_002332881.1| conjugal transfer protein [Klebsiella pneumoniae]
MKKTLTAVLLTTGLILGGAQSASAGIIVTNPTELAKQVEQLQQMAQQLEQLKSQLQTQKNMYESMAKTTN
LGDLLGTSTSTLANNLPDNWKEIYSDAMNSSSSVTPSVNSMMGQFNAEVDDMTPSEAITYMNKKLAEKGA
YDRVMAEKAYNNQMQELTDMQELTEQIKTTPDLKSIADLQARIQTSQGAIQGEQAKLNLMNMLQQSQDKL
LRAQKERATHNFVFGTGGDVTASPSIN
 
Nucleotide Sequence: 714 bp     [Download]
>gi|215528069|ref|NC_011617.1|:38317-39030 Klebsiella pneumoniae plasmid pKP96, complete sequence
ATGAAAAAAACACTGACGGCAGTATTGCTGACCACCGGCCTGATTCTGGGAGGCGCGCAAAGCGCTTCCG
CAGGCATCATCGTGACCAACCCTACTGAGCTGGCTAAACAGGTCGAGCAGCTTCAGCAAATGGCGCAGCA
GCTGGAGCAGCTTAAAAGCCAGCTGCAAACGCAGAAAAATATGTATGAGTCGATGGCAAAGACAACCAAC
CTGGGCGATCTGCTGGGGACGTCTACCAGCACGCTGGCAAATAATTTGCCGGACAACTGGAAGGAGATCT
ACAGCGACGCCATGAACTCCAGTTCTTCCGTCACGCCTTCAGTTAACAGCATGATGGGCCAGTTTAATGC
GGAAGTTGACGACATGACGCCCAGCGAAGCAATTACCTACATGAACAAAAAGCTGGCTGAAAAAGGCGCT
TATGACCGCGTTATGGCAGAAAAAGCCTACAACAACCAGATGCAGGAACTAACCGATATGCAGGAGCTGA
CGGAGCAGATTAAAACGACTCCAGACCTGAAATCGATTGCTGACTTACAGGCCCGTATCCAGACGTCACA
GGGTGCTATTCAGGGTGAGCAGGCGAAGCTGAATCTGATGAACATGTTGCAGCAGTCACAGGACAAGCTA
TTACGTGCGCAGAAAGAACGTGCCACCCACAATTTTGTTTTTGGAACCGGCGGGGACGTTACCGCGTCAC
CTTCAATTAACTGA
 Primer design