SecReT4
Protein ID: 215528075
T4SS name [ID]Trw [148]
Gene symboltraL
Locus tagpKP96_033
StrainKlebsiella pneumoniae plasmid pKP96 (NC_011617)
Repliconplasmid pKP96 [GenBank: NC_011617] [Browse all T4SS(s) in this replicon]
Location [Strand]34005..34739 [+]
Productconjugal transfer protein
Component typeTrwN
UniProt IDB6RFN9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 6.7e-34, Aligned region: 31..176
Protein Sequence: 244 a.a.     [Download]
>gi|215528075|ref|YP_002332877.1| conjugal transfer protein [Klebsiella pneumoniae]
MSKHPKLLVLALACLACAGRASAAPASDEVARLAQRCAPDVSPLTMAYIVGHESSNGPYRININGSIQLK
QQPRTEAEAVSVAKVLLKDNKSFDMGLAQINSNNLVGLGLSVDDIFKPCINLRASQTILKACYDSALKSY
PAGQVALRHALSCYNTGSLTNGISNGYVTKVINVARQSTDLKIPTLLPDGQTSEDSTATEPQQAKSTAPQ
YDGEQDVFGSGDGDAFSRNNTDAFLTRQETAKGE
 
Nucleotide Sequence: 735 bp     [Download]
>gi|215528069|ref|NC_011617.1|:34005-34739 Klebsiella pneumoniae plasmid pKP96, complete sequence
ATGAGTAAACATCCAAAACTCCTGGTTCTCGCTCTGGCCTGCCTTGCTTGTGCTGGCCGTGCCAGTGCTG
CGCCTGCCTCCGATGAAGTTGCCAGGCTTGCGCAGAGATGTGCGCCTGATGTTTCACCCTTAACGATGGC
GTACATCGTCGGCCATGAGTCCTCAAATGGGCCGTACAGGATCAATATTAACGGTAGTATTCAGTTAAAA
CAGCAACCGCGTACTGAAGCTGAGGCCGTCAGCGTTGCGAAAGTTCTGCTGAAGGATAATAAAAGTTTTG
ATATGGGCCTTGCACAAATTAACTCAAATAATTTAGTGGGCCTGGGTCTTTCGGTTGACGATATTTTCAA
ACCCTGCATCAACCTGCGGGCGAGCCAGACCATCCTTAAAGCCTGTTATGATAGCGCCCTGAAATCCTAC
CCAGCCGGGCAGGTTGCGCTGAGACACGCGCTTTCCTGCTACAACACCGGCTCACTCACAAACGGGATTT
CTAACGGGTATGTCACGAAAGTTATCAACGTGGCGCGTCAATCAACTGATTTGAAAATCCCTACGCTGCT
ACCTGACGGCCAGACCAGTGAGGACAGCACCGCGACTGAGCCTCAGCAGGCAAAAAGTACGGCGCCGCAG
TATGACGGTGAACAAGATGTTTTTGGTTCGGGTGATGGCGATGCCTTCAGCCGAAATAATACGGATGCCT
TTTTAACCAGACAGGAAACAGCGAAGGGGGAATGA
 Primer design