SecReT4
Protein ID: 215528121
T4SS name [ID]Trw [148]
Gene symboltraF
Locus tagpKP96_044
StrainKlebsiella pneumoniae plasmid pKP96 (NC_011617)
Repliconplasmid pKP96 [GenBank: NC_011617] [Browse all T4SS(s) in this replicon]
Location [Strand]42133..43293 [+]
Productconjugal transfer protein
Component typeTrwE
UniProt IDB6RFP9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.3e-54, Aligned region: 202..377
Protein Sequence: 386 a.a.     [Download]
>gi|215528121|ref|YP_002332887.1| conjugal transfer protein [Klebsiella pneumoniae]
MARKSVDVDQELDENTGDGEFESERGGFKGSNRRSAPGMKAFVILMALLALVFIGITVMGKIRTPAKAEA
DKDGGKAQQANTLPNYSFNSDPDVNKPATAQNSATDARAVQAAAQADADAGSSNTAARTSNKRKEPSPEE
LAMQRRLGGELAQTNQAATSNSPGVQPQDNETSEGSSALAKNLTPARLKASRAGVMANPSLTVPKGKMIP
CGTGTELDTTVPGQVSCRVSQDVYSADGLVRLIDKGSWVDGQITGGIKDGQARVFVLWERIRNDQDGTIV
NIDSAGTNSLGSAGIPGQVDTHMWERLRGAIMISLFSDTLTALVNQTQSNNIQYNSTENSGEQLASEALR
SYMSIPPTLYDQQGDAVSIFVARDLDFSGVYTLADN
 
Nucleotide Sequence: 1161 bp     [Download]
>gi|215528069|ref|NC_011617.1|:42133-43293 Klebsiella pneumoniae plasmid pKP96, complete sequence
ATGGCCCGTAAAAGTGTCGATGTAGATCAGGAACTCGATGAAAACACCGGAGACGGTGAATTTGAAAGCG
AGCGTGGCGGATTTAAAGGCAGTAACCGCCGTTCGGCTCCTGGTATGAAAGCCTTTGTCATACTGATGGC
GCTGCTTGCTTTGGTATTCATCGGGATTACGGTCATGGGTAAAATTCGCACCCCGGCTAAAGCTGAAGCT
GATAAAGACGGTGGTAAAGCGCAACAGGCCAATACACTGCCAAACTACAGCTTTAACAGCGATCCTGATG
TTAATAAACCTGCAACTGCGCAGAATAGCGCCACTGATGCCCGTGCTGTGCAGGCTGCCGCACAGGCAGA
TGCAGATGCGGGCAGCAGCAATACCGCCGCGCGTACCTCTAATAAGCGTAAAGAACCTTCGCCTGAAGAA
CTGGCTATGCAGCGTCGTCTGGGCGGCGAGCTGGCCCAGACTAATCAGGCGGCTACAAGCAATAGTCCCG
GAGTGCAGCCCCAGGACAACGAAACAAGCGAAGGTAGTTCAGCACTCGCTAAAAACCTGACTCCTGCAAG
GCTGAAGGCTAGCCGCGCTGGAGTCATGGCTAATCCCAGCCTGACTGTTCCGAAAGGCAAAATGATCCCC
TGTGGTACCGGCACCGAGCTGGATACCACTGTTCCGGGTCAGGTTTCCTGCCGGGTTTCACAGGACGTTT
ACTCAGCTGATGGACTCGTTAGGCTGATTGATAAAGGCTCATGGGTTGACGGGCAGATTACCGGTGGTAT
CAAAGACGGCCAGGCGCGCGTGTTTGTTCTCTGGGAGCGTATCCGCAATGACCAGGACGGGACAATCGTT
AATATTGACAGTGCCGGAACGAACTCACTCGGCAGCGCGGGGATTCCGGGCCAGGTGGATACCCATATGT
GGGAGCGTCTGCGTGGTGCGATCATGATTTCGTTGTTCTCTGACACCTTAACGGCGCTGGTTAACCAGAC
GCAGAGTAATAACATTCAGTACAACAGCACAGAAAACAGCGGTGAGCAGCTGGCGTCTGAAGCACTTCGC
TCTTACATGTCTATCCCCCCTACCCTCTACGATCAGCAGGGTGATGCGGTGAGCATTTTTGTTGCCCGCG
ACCTCGATTTCAGCGGCGTTTATACGCTCGCAGACAACTAA
 Primer design