SecReT4
Protein ID: 215528122
T4SS name [ID]Trw [148]
Gene symboltraO
Locus tagpKP96_043
StrainKlebsiella pneumoniae plasmid pKP96 (NC_011617)
Repliconplasmid pKP96 [GenBank: NC_011617] [Browse all T4SS(s) in this replicon]
Location [Strand]41249..42133 [+]
Productconjugal transfer protein
Component typeTrwF
UniProt IDB6RFP8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.4e-57, Aligned region: 33..267
Protein Sequence: 294 a.a.     [Download]
>gi|215528122|ref|YP_002332886.1| conjugal transfer protein [Klebsiella pneumoniae]
MKKLLLSAVVLSVLGGAATNVMALEVGRNSPYDYRIKSVVYNPVNVVKIDAIAGVATHIVVAPDETYITH
AFGDSESWTFAHKMNHFFVKPKQAMSDTNLVIVTDKRTYNIVLHFIGEETKKNADGTVSKSFIETPWAVR
QAVLQLTYEYPFEQQEKAKSAADKKRITQKLKQTAFAGAKNYQYVMSEQPEMRSIQPVHVWDNYRFTRFE
FPANAELPQVYMISASGKETLPNSHVVGENRNIIEVETVAKEWRIRLGDKVVGVRNNNFAPGAGAVATGT
ASPDVRRVQIGEDN
 
Nucleotide Sequence: 885 bp     [Download]
>gi|215528069|ref|NC_011617.1|:41249-42133 Klebsiella pneumoniae plasmid pKP96, complete sequence
ATGAAAAAACTACTTCTTTCAGCAGTCGTTTTGTCAGTCCTGGGAGGCGCGGCCACTAACGTTATGGCGC
TTGAGGTTGGCCGCAATTCTCCTTATGACTATCGCATTAAAAGCGTTGTTTATAACCCTGTTAATGTGGT
CAAAATTGACGCTATCGCCGGTGTGGCTACCCACATTGTTGTCGCGCCTGACGAAACCTATATCACTCAT
GCTTTTGGCGATTCTGAAAGCTGGACGTTTGCGCACAAAATGAACCATTTTTTTGTGAAGCCGAAACAGG
CCATGAGTGATACCAACCTGGTGATCGTCACCGATAAGCGCACCTATAACATCGTCCTCCATTTCATCGG
TGAAGAAACGAAGAAAAATGCAGACGGTACGGTATCAAAATCCTTTATTGAAACGCCGTGGGCTGTGCGC
CAGGCCGTTCTTCAGCTGACCTATGAATATCCGTTTGAGCAGCAGGAAAAAGCCAAAAGCGCGGCTGATA
AAAAACGCATTACGCAGAAGCTGAAGCAGACGGCTTTTGCGGGGGCGAAGAACTATCAGTACGTAATGAG
CGAACAGCCTGAAATGCGCAGCATCCAGCCGGTTCACGTCTGGGATAACTACCGCTTTACCCGGTTTGAG
TTTCCGGCCAATGCGGAGTTACCGCAGGTCTACATGATCTCGGCCAGTGGCAAAGAAACGCTGCCTAACT
CTCATGTTGTGGGTGAGAACCGCAACATCATCGAGGTGGAAACCGTCGCTAAAGAGTGGCGTATTCGTCT
GGGCGATAAAGTCGTTGGCGTTCGTAATAATAATTTCGCGCCGGGCGCCGGTGCGGTAGCAACCGGTACG
GCTTCCCCGGATGTGCGCAGGGTTCAAATTGGGGAGGATAACTGA
 Primer design