SecReT4
Protein ID: 215528129
T4SS name [ID]Trw [148]
Gene symbol-
Locus tagpKP96_035
StrainKlebsiella pneumoniae plasmid pKP96 (NC_011617)
Repliconplasmid pKP96 [GenBank: NC_011617] [Browse all T4SS(s) in this replicon]
Location [Strand]35039..35332 [+]
Productconjugal transfer protein
Component typeTrwL
UniProt IDB6RFP1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.4e-06, Aligned region: 11..91
Protein Sequence: 97 a.a.     [Download]
>gi|215528129|ref|YP_002332879.1| conjugal transfer protein [Klebsiella pneumoniae]
MTTLFKKYGPAVVMGVLSIALPQIALAAGTDTGESTATSIQTWLSTWIPIGCAIAIMVSCFMWMLHVIPA
SFIPRIVISLIGIGSASFLVSLTGVGS
 
Nucleotide Sequence: 294 bp     [Download]
>gi|215528069|ref|NC_011617.1|:35039-35332 Klebsiella pneumoniae plasmid pKP96, complete sequence
ATGACCACGTTGTTTAAGAAGTATGGCCCTGCGGTAGTTATGGGCGTTTTGTCCATTGCCCTGCCGCAAA
TTGCGCTGGCCGCTGGCACCGATACTGGTGAATCAACCGCTACATCAATCCAGACGTGGTTGAGCACATG
GATTCCAATTGGTTGTGCTATTGCGATCATGGTTAGTTGCTTTATGTGGATGCTTCACGTAATCCCAGCC
AGCTTTATTCCTCGTATCGTAATCTCGCTGATTGGTATTGGTTCTGCATCATTTCTGGTTTCCCTGACGG
GCGTAGGAAGCTGA
 Primer design