SecReT4
Protein ID: 215778353
T4SS name [ID]Tra_F [536]
Gene symboltraL
Locus tagVSAL_p840_03
StrainAliivibrio salmonicida LFI1238
Repliconplasmid pVSAL840 [GenBank: NC_011311] [Browse all T4SS(s) in this replicon]
Location [Strand]733..1035 [+]
Productconjugative transfer protein TraL
Component typeTraL_F
UniProt IDB6ESX4
KEGG IDvsa:VSAL_p840_03
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.2e-25, Aligned region: 7..99
Protein Sequence: 100 a.a.     [Download]
>gi|215778353|ref|YP_002261493.1| conjugative transfer protein TraL [Aliivibrio salmonicida LFI1238]
MEDPHLFYAIPKHLNKGKTIVGLPQSEVLPALLLFAVFFIAKHQLIGLVIGVVWFAGLRIIKTKYGDNII
PLALHWYGSTHVNQHLFTRTPSANKRYWIF
 
Nucleotide Sequence: 303 bp     [Download]
>gi|215778350|ref|NC_011311.1|:733-1035 Aliivibrio salmonicida LFI1238 plasmid pVSAL840, complete sequence
ATGGAAGATCCTCATTTGTTCTACGCCATCCCAAAACACCTAAACAAAGGAAAAACCATTGTCGGGTTAC
CCCAGAGTGAGGTTCTTCCCGCCCTACTGTTATTTGCTGTTTTCTTTATCGCCAAGCATCAACTCATCGG
GTTGGTGATTGGCGTTGTCTGGTTTGCCGGTCTGCGCATAATTAAAACCAAGTACGGGGACAACATCATT
CCTCTTGCTCTGCACTGGTACGGCTCCACGCACGTCAATCAACACCTGTTTACTCGCACACCATCCGCCA
ACAAACGATACTGGATATTCTAA
 Primer design