SecReT4
Protein ID: 215778364
T4SS name [ID]Tra_F [536]
Gene symboltraF
Locus tagVSAL_p840_14
StrainAliivibrio salmonicida LFI1238
Repliconplasmid pVSAL840 [GenBank: NC_011311] [Browse all T4SS(s) in this replicon]
Location [Strand]11549..12292 [+]
Productconjugative transfer protein TraF
Component typeTraF_F
UniProt IDB6ESY5
KEGG IDvsa:VSAL_p840_14
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.8e-70, Aligned region: 22..236
Protein Sequence: 247 a.a.     [Download]
>gi|215778364|ref|YP_002261504.1| conjugative transfer protein TraF [Aliivibrio salmonicida LFI1238]
MNRCIAMIAFFVSTGVLAAPNGWRWYNEPTQDAKAPAPITKPNTVTRTLSARAQLTWFKEQHQEAQAAAT
IDPSNNQKVEKAMRLNQYVSNQSSQFGMTFKEVLLSHPELSYTKDRPVEQAARSTYLELEREKKVHTIKQ
MAAEGWGFFFVYEGKDTLSQTLAPSIQQFATTHGIEVLGISKDGTTLESIRENRMDDNTLNVAYLPALLL
VNPNTKTIKPLAYGFISQDQLLGRFYNVATHYNSPDF
 
Nucleotide Sequence: 744 bp     [Download]
>gi|215778350|ref|NC_011311.1|:11549-12292 Aliivibrio salmonicida LFI1238 plasmid pVSAL840, complete sequence
ATGAATCGATGCATCGCAATGATCGCCTTTTTCGTCAGTACCGGTGTATTGGCTGCGCCTAACGGATGGC
GATGGTATAACGAGCCAACCCAAGACGCTAAGGCACCGGCGCCCATCACAAAGCCAAACACGGTGACTCG
CACCTTAAGTGCCCGCGCACAATTAACGTGGTTTAAAGAGCAACACCAAGAAGCGCAAGCCGCCGCCACG
ATTGACCCAAGCAACAACCAAAAAGTAGAAAAAGCGATGCGACTCAATCAATACGTGTCCAATCAATCCT
CTCAATTTGGCATGACCTTTAAAGAAGTCTTATTGAGTCACCCTGAGCTGTCTTACACCAAAGACAGACC
CGTAGAGCAAGCGGCACGAAGCACGTATTTAGAGCTGGAGCGCGAGAAAAAAGTGCACACCATTAAACAA
ATGGCCGCTGAGGGATGGGGATTTTTCTTTGTGTATGAAGGCAAAGACACGTTAAGCCAAACCCTCGCGC
CAAGCATTCAGCAATTTGCGACCACCCATGGCATTGAGGTGCTAGGGATAAGCAAAGACGGCACCACACT
AGAGAGCATCAGAGAAAACAGAATGGACGACAACACCCTGAACGTGGCGTATTTGCCCGCGCTGCTGCTT
GTGAACCCCAACACAAAAACCATTAAGCCGTTGGCGTATGGATTTATTTCACAAGACCAATTATTGGGGC
GTTTTTACAACGTGGCCACCCATTACAACAGCCCTGATTTTTAA
 Primer design