SecReT4
Protein ID: 215778373
T4SS name [ID]Tra_F [536]
Gene symbolpilT
Locus tagVSAL_p840_23
StrainAliivibrio salmonicida LFI1238
Repliconplasmid pVSAL840 [GenBank: NC_011311] [Browse all T4SS(s) in this replicon]
Location [Strand]27390..27827 [-]
Producttransglycosylase PilT
Component typeOrf169_F
UniProt IDB6ESZ4
KEGG IDvsa:VSAL_p840_23
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 145 a.a.     [Download]
>gi|215778373|ref|YP_002261513.1| transglycosylase PilT [Aliivibrio salmonicida LFI1238]
MKLNILFLSVASLNVNAFCFEEAGRYYDVSPTLLTSIAMVESNLQADAVNENRNKRGEVVSVDYGLMQIN
STWFSRLSRFGVSKDNLLNDACFNVHIGAWVLSQNFASHGYNWNSIGAYNAGFSAKNAAARARYIRKVQA
ALASL
 
Nucleotide Sequence: 438 bp     [Download]
>gi|215778350|ref|NC_011311.1|:c27827-27390 Aliivibrio salmonicida LFI1238 plasmid pVSAL840, complete sequence
ATGAAATTAAATATCCTGTTTTTATCTGTGGCGTCATTGAATGTGAACGCGTTCTGTTTTGAAGAGGCTG
GGCGTTATTACGATGTTAGCCCAACCTTGTTAACATCGATTGCGATGGTTGAAAGTAATCTACAGGCCGA
TGCGGTGAATGAAAACAGAAACAAGCGCGGAGAGGTGGTGAGTGTCGATTATGGATTGATGCAAATCAAT
TCGACGTGGTTCTCTCGTTTATCTCGGTTTGGGGTCAGCAAAGATAATTTACTGAATGACGCCTGTTTTA
ATGTTCACATTGGTGCGTGGGTTCTGTCTCAAAACTTCGCGAGCCATGGTTATAACTGGAACAGTATCGG
GGCGTATAATGCGGGATTCAGTGCGAAGAATGCCGCGGCTAGAGCACGATACATTAGAAAAGTTCAAGCG
GCGTTAGCGAGCTTGTAA
 Primer design