SecReT4
Protein ID: 21628940
T4SS name [ID]VirB [201]
Gene symbolbpl17
Locus tagpF3028_p18
StrainHaemophilus influenzae biotype aegyptius plasmid pF3028 (NC_004058)
Repliconplasmid pF3028 [GenBank: NC_004058] [Browse all T4SS(s) in this replicon]
Location [Strand]15072..15227 [+]
ProductTraF-like protein
Component typeVirB7
UniProt IDQ8VRD2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 51 a.a.     [Download]
>gi|21628940|ref|NP_660233.1| TraF-like protein [Haemophilus influenzae biotype aegyptius]
MKTLFLIITTSLLLSACSSPPQPNEPKGKWYQINSSHYYEENANKTITTKP
 
Nucleotide Sequence: 156 bp     [Download]
>gi|21628923|ref|NC_004058.1|:15072-15227 Haemophilus influenzae biotype aegyptius BPF plasmid pF3028, complete sequence
ATGAAAACTCTATTTTTAATTATAACCACATCATTGTTACTTTCGGCTTGTAGCTCACCGCCGCAACCGA
ATGAGCCTAAAGGAAAGTGGTATCAAATCAACAGCTCTCACTACTACGAAGAGAACGCTAACAAAACAAT
CACAACAAAGCCGTAA
 Primer design