SecReT4
Protein ID: 21628941
T4SS name [ID]VirB [201]
Gene symbolbpl18
Locus tagpF3028_p19
StrainHaemophilus influenzae biotype aegyptius plasmid pF3028 (NC_004058)
Repliconplasmid pF3028 [GenBank: NC_004058] [Browse all T4SS(s) in this replicon]
Location [Strand]15241..16014 [+]
ProductTraG-like protein
Component typeVirB8
UniProt IDQ8VRD1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.8e-59, Aligned region: 42..251
Protein Sequence: 257 a.a.     [Download]
>gi|21628941|ref|NP_660234.1| TraG-like protein [Haemophilus influenzae biotype aegyptius]
MKIFNRSKPKLLNENVEALAEEPTPAERKIVNERAKEHFKRKQEFEKDRVGFYKTLSKVGFGVGGIGALI
GLAGVIAVAGLTPLKTSEPYVIRVDNNTGFTDIVKPISDSSQTTYGEELDKYWLSKFIIERESYDWQLVQ
NSYDAVELMTTPQVFNEYKAYITSKVSPVNLLQQNKKIKVRVLSVSFINGIGQVRFSKQVLTASGDPDSV
IPTTYWLASIPFDYKHDIKLEQQRLINPLGFQALSYRADPESNLSEK
 
Nucleotide Sequence: 774 bp     [Download]
>gi|21628923|ref|NC_004058.1|:15241-16014 Haemophilus influenzae biotype aegyptius BPF plasmid pF3028, complete sequence
ATGAAAATTTTTAACCGTTCTAAACCAAAATTATTAAATGAGAACGTGGAAGCGTTGGCTGAAGAGCCAA
CGCCAGCCGAAAGAAAAATCGTAAATGAAAGAGCCAAAGAACACTTTAAACGTAAACAAGAGTTTGAGAA
AGATCGTGTTGGTTTTTACAAAACACTTTCAAAAGTTGGTTTTGGTGTCGGTGGCATAGGGGCATTAATT
GGTCTTGCAGGCGTAATTGCCGTTGCAGGTCTTACTCCATTAAAAACATCGGAGCCGTATGTAATCCGTG
TCGATAACAATACAGGCTTTACCGATATTGTTAAACCTATTTCTGATAGTTCCCAAACCACATACGGCGA
GGAGTTAGACAAATATTGGCTCTCGAAGTTCATTATTGAACGAGAATCTTATGATTGGCAGCTCGTGCAA
AATTCGTATGACGCAGTAGAGCTGATGACAACGCCTCAAGTATTTAACGAATATAAGGCTTACATCACAA
GTAAAGTATCTCCAGTAAATTTATTACAACAAAACAAGAAAATTAAAGTGCGTGTACTTTCTGTTTCATT
TATTAACGGTATCGGTCAAGTCAGATTCTCAAAACAAGTTTTGACGGCAAGCGGTGATCCTGATTCCGTT
ATCCCTACGACTTATTGGCTTGCTTCAATTCCTTTTGACTATAAGCACGACATCAAGCTTGAGCAGCAAC
GTTTAATCAATCCATTAGGATTTCAGGCTTTAAGCTATCGTGCTGACCCTGAAAGTAATTTGAGTGAGAA
ATAG
 Primer design