SecReT4
Protein ID: 21628944
T4SS name [ID]VirB [201]
Gene symbolbpl21
Locus tagpF3028_p22
StrainHaemophilus influenzae biotype aegyptius plasmid pF3028 (NC_004058)
Repliconplasmid pF3028 [GenBank: NC_004058] [Browse all T4SS(s) in this replicon]
Location [Strand]17983..19041 [+]
ProductTraJ-like protein
Component typeVirB11
UniProt IDQ8VRC8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.1e-52, Aligned region: 26..329
Protein Sequence: 352 a.a.     [Download]
>gi|21628944|ref|NP_660237.1| TraJ-like protein [Haemophilus influenzae biotype aegyptius]
MNLENEELEAGHIDNSAVARAMLKKTGIQAILDREDITEVAVNQGNRIFFEGKNGWEYVEAPECNYHNLK
ALANALSVFSGLKLPFGDQNPIISVVLPDGERGQILTHPATESGTIPITLRKPSKTRFTVDDYQNSGRFS
KIQIAEAYQKGTIPLYMQQMKKCQKEGNYAEFFRIAAAHNMNTIAVGGTGSGKTTFAKAYADLVPFDHRT
ITIEDVHELSLPYHWNHLHLFFDTEYQKSGGISPKELIKSAMRMKPDHIFLTELRGDETWNYFEALNTGH
NGSITSTHANDCRATIPRLTGLVMQSEIGKVLGEQYIQKTLSSALDVICYFKHTYMTEILFEPEKKLEAM
YE
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|21628923|ref|NC_004058.1|:17983-19041 Haemophilus influenzae biotype aegyptius BPF plasmid pF3028, complete sequence
ATGAATCTTGAAAATGAAGAATTAGAAGCAGGGCATATTGATAATTCAGCCGTTGCAAGAGCAATGCTTA
AAAAAACAGGTATTCAAGCGATCTTAGATCGTGAAGATATTACTGAAGTCGCCGTAAATCAAGGAAATCG
TATTTTCTTTGAGGGCAAGAATGGCTGGGAATATGTAGAAGCTCCTGAATGTAACTATCACAACCTCAAG
GCGTTAGCTAACGCCTTGAGCGTGTTCAGCGGCTTAAAACTCCCATTTGGCGATCAAAACCCGATTATTT
CAGTTGTACTTCCTGACGGAGAACGTGGGCAGATTCTAACCCACCCAGCAACCGAATCAGGCACAATTCC
GATCACTTTGCGTAAACCCTCAAAAACTCGTTTTACTGTTGATGATTACCAAAATTCAGGGCGTTTTAGC
AAAATTCAGATTGCCGAAGCCTATCAAAAAGGCACGATTCCGCTTTATATGCAGCAAATGAAGAAATGCC
AAAAAGAGGGCAATTATGCTGAATTTTTTAGAATCGCCGCAGCTCACAATATGAATACGATTGCCGTAGG
CGGCACAGGCTCAGGTAAAACTACGTTTGCAAAAGCCTATGCAGACTTAGTACCGTTCGATCATCGCACT
ATTACAATCGAAGACGTTCACGAATTAAGTCTACCGTATCATTGGAATCATCTACACCTATTTTTTGATA
CTGAATATCAAAAATCAGGAGGGATTAGCCCAAAAGAACTTATTAAGTCAGCAATGCGTATGAAGCCTGA
TCATATTTTCTTAACAGAGTTACGGGGCGATGAAACTTGGAATTATTTTGAGGCATTAAACACAGGACAC
AATGGCAGTATTACCTCTACGCACGCTAATGATTGTAGAGCAACAATTCCTCGTTTAACAGGGCTTGTAA
TGCAATCTGAAATCGGCAAAGTGTTAGGTGAGCAATATATTCAAAAAACATTGAGTAGTGCTTTAGACGT
GATTTGTTACTTCAAGCATACCTATATGACTGAAATCTTATTCGAGCCTGAAAAGAAACTCGAAGCAATG
TATGAATAA
 Primer design