SecReT4
Protein ID: 216967785
T4SS name [ID]Tra_I [181]
Gene symboltraL
Locus tagpCTXM360_p10
StrainKlebsiella pneumoniae plasmid pCTXM360 (NC_011641)
Repliconplasmid pCTXM360 [GenBank: NC_011641] [Browse all T4SS(s) in this replicon]
Location [Strand]10202..10714 [+]
ProductTraL
Component typeTraL_I
UniProt IDB7T4T3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 170 a.a.     [Download]
>gi|216967785|ref|YP_002333293.1| TraL [Klebsiella pneumoniae]
MHQSQSQRLGHKTKTLLVAVGFSCISVSSFAATQTCAAYELAKAGADAAYKQEVERINNAAKSESSTSDS
LGQCLGSLSVSLKIPQFPSISDIIDKVKDEVCNTVKSKINEKWGSLTNTTLDPWSTISSRLPDTSGILPN
ASSKNVQLNNPAAASGSGEDANSDAFPFHL
 
Nucleotide Sequence: 513 bp     [Download]
>gi|216967777|ref|NC_011641.1|:10202-10714 Klebsiella pneumoniae plasmid pCTXM360, complete sequence
ATGCACCAGTCGCAAAGTCAGCGCCTCGGCCATAAAACAAAAACCCTACTCGTAGCAGTAGGGTTTTCCT
GCATTTCTGTGAGCTCATTTGCAGCCACACAGACCTGTGCAGCATACGAACTGGCAAAAGCTGGTGCTGA
TGCTGCCTATAAACAGGAGGTTGAACGGATTAACAACGCCGCTAAAAGTGAATCCAGTACATCTGATTCT
CTCGGACAGTGCCTGGGGTCGCTATCGGTATCACTAAAAATCCCTCAATTTCCGTCTATCAGCGACATCA
TTGATAAGGTGAAGGATGAGGTATGCAATACGGTTAAATCGAAGATAAATGAGAAGTGGGGGAGCCTGAC
TAATACAACGCTGGACCCGTGGTCAACGATTTCATCCCGACTGCCAGATACGTCAGGTATCCTGCCCAAC
GCATCTTCTAAGAATGTGCAATTAAACAATCCGGCAGCTGCGAGTGGAAGTGGTGAGGATGCAAACAGTG
ATGCATTCCCGTTCCATTTGTAA
 Primer design