SecReT4
Protein ID: 216967787
T4SS name [ID]Tra_I [181]
Gene symboltraM
Locus tagpCTXM360_p12
StrainKlebsiella pneumoniae plasmid pCTXM360 (NC_011641)
Repliconplasmid pCTXM360 [GenBank: NC_011641] [Browse all T4SS(s) in this replicon]
Location [Strand]11308..12090 [+]
ProductTraM
Component typeTraM_I
UniProt IDB7T4T5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 5.9e-32, Aligned region: 109..216
Protein Sequence: 260 a.a.     [Download]
>gi|216967787|ref|YP_002333295.1| TraM [Klebsiella pneumoniae]
MYTSLFINDLRDFLTQTFEKRNSMKTQNGENIMDQTDSDQNSVVDDDSNALAPALAEESNRTVQEIVSKH
GLKVILIQTLIILVAIIIIGLQGYWLHQKKIKYIATNGGMITEVHPTDEPAYTAEEVMDFANRTMIKSLS
LNFVNYENQLTSVRGDFSAEGYVSFRKALSDSGLLKDISEKRLNVKLSTTPGTLITEGLIRGTKTYAWQY
RIPVTVQLVGQAQDYRPQPYDLMVQVRRVKEDEDPRGIQVAQAILKPRNY
 
Nucleotide Sequence: 783 bp     [Download]
>gi|216967777|ref|NC_011641.1|:11308-12090 Klebsiella pneumoniae plasmid pCTXM360, complete sequence
ATGTATACCTCATTGTTCATTAACGATCTGCGTGATTTTCTAACACAAACTTTTGAAAAGAGAAACTCTA
TGAAAACACAAAATGGTGAAAATATTATGGATCAAACTGACTCGGATCAAAACTCAGTCGTTGATGATGA
CAGCAACGCCCTTGCTCCAGCTCTGGCTGAAGAGAGTAACCGAACGGTACAAGAAATCGTATCGAAACAT
GGTTTAAAAGTAATTTTGATTCAAACGCTAATCATATTAGTCGCAATCATTATCATTGGTCTTCAGGGTT
ACTGGCTTCACCAGAAAAAAATCAAATATATTGCAACGAATGGGGGCATGATCACAGAAGTTCATCCAAC
CGATGAACCCGCTTACACGGCGGAAGAGGTGATGGACTTTGCCAACCGTACAATGATCAAATCGCTTTCA
CTGAACTTTGTGAATTACGAAAACCAATTAACCAGCGTCCGCGGCGATTTTAGCGCTGAAGGGTACGTTA
GTTTCCGTAAAGCGCTGTCCGATAGTGGGCTGCTGAAAGATATCAGTGAAAAACGTCTGAACGTAAAACT
TTCCACAACTCCTGGAACCCTGATCACGGAAGGTCTTATCCGTGGCACCAAAACCTATGCCTGGCAATAC
CGCATTCCGGTGACTGTTCAGCTTGTTGGGCAGGCTCAGGACTACAGACCGCAACCTTACGATTTGATGG
TTCAGGTACGCCGCGTCAAAGAAGACGAAGATCCACGGGGTATTCAAGTAGCACAGGCCATTCTCAAACC
CCGGAACTACTGA
 Primer design