SecReT4
Protein ID: 216967794
T4SS name [ID]Tra_I [181]
Gene symboltraU
Locus tagpCTXM360_p20
StrainKlebsiella pneumoniae plasmid pCTXM360 (NC_011641)
Repliconplasmid pCTXM360 [GenBank: NC_011641] [Browse all T4SS(s) in this replicon]
Location [Strand]16825..19875 [+]
ProductTraU
Component typeTraU_I
UniProt IDB7T4U2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 7.9e-60, Aligned region: 490..888
Protein Sequence: 1016 a.a.     [Download]
>gi|216967794|ref|YP_002333302.1| TraU [Klebsiella pneumoniae]
MISFFEDVIEGISRNLTSNDSLKYCDLTTVVGLTSQDRVEHPEIRAPYILTTKNNDFLTVIEVQGAKSSF
DEKSFNDFIMHLSNSLSNSFINSGHKLSVVFERDFTKNQEELNNVYKPQVAAIERLQIDIKDLIADDAKK
IAAHYSRERAYIVLYTSKGMIAKDELKNEQAKAAGVLKDIPQTRFSQNPIEFQLEGLKITHDAMLWRLIG
MLQGDDESGMGLLVDVLDVKHAGAMMRQMLFRNSTSENWYPRTPFDQNLRIYGAPRKDNIDSVLPPRLNI
QIMEGELEEDGGLIYCDGKYYGSVALELPPLHPVKFKQLFNAINRKIPYRIKYDFIGGGKKALFWPSVII
SFLRFIPSLGNIARDMDYVRAQSETDPTAIMAINFATWGDTKDEAKRNLAALTKAIEGWGVSGVSKTYGN
PGSALIASVPGLTTATPGSLHYPPLSEGLRMLPFERPASPWHGKGNINFITLDGKLFPYQIASPLQEKFT
DVITGVPGSGKSVLANRLNLSSIYRADKKLPYLTIIDKGYSAKGIADLISAELPSEKRHQIASITLNNDE
SHCINICDTQLGSRYLTQFEEVFLKQMLNAFCIDPAIGQPPDAMSVGQIVSKVVSNVYKAKAHSSANLFK
YNDPVINEALKESGLDKELGEDWFERATWWEVVDKLFAKKYLHAATVAQRYAVPTIHDFIAELQTESFKN
QYADVKVNGSEPVVGFVARCFQAAAAEYAIFSGITVYDFSPETRIAILDMQNVLGDRTTPAGKLKSGIMY
LFARQMAVRNYYLPQSAETFIPALPEQYRAYHQARIRELSEEVKHTFYDECHNFAGIDFIQNALNTADLE
DRKFNVRTAFSSQYLSHMPSSVLKTMNSLFMMRLTEGDEEYLKQLEINIPADILRRFRQLPQGVYPDGSG
TAFLGIFKTKRGLICHILKNTLGPKLLWALNSSAKDRALRDVLYEELGTKKAREELANRFPMGSASSIID
EMVVNQGGERDSEEESQTMAMKLAKEIISDVRRGFR
 
Nucleotide Sequence: 3051 bp     [Download]
>gi|216967777|ref|NC_011641.1|:16825-19875 Klebsiella pneumoniae plasmid pCTXM360, complete sequence
ATGATTTCTTTCTTTGAGGATGTGATCGAAGGTATCTCACGCAATCTGACATCAAATGACTCGTTAAAAT
ACTGTGATTTGACAACGGTTGTAGGGCTTACGTCGCAGGATCGCGTTGAGCATCCTGAAATCAGGGCTCC
GTACATTCTGACCACTAAGAACAACGATTTTCTTACCGTTATTGAGGTTCAGGGCGCTAAATCATCGTTT
GACGAGAAGTCGTTTAATGACTTCATCATGCACCTATCAAACTCCTTGTCGAATTCCTTTATTAACAGCG
GCCATAAGTTGTCTGTGGTGTTCGAACGCGACTTTACCAAGAACCAGGAAGAGCTGAATAATGTTTATAA
ACCGCAGGTAGCAGCAATAGAGCGTCTGCAGATAGACATTAAAGACCTGATCGCCGATGACGCAAAAAAA
ATCGCCGCTCATTACAGCCGTGAACGCGCTTACATCGTGCTGTATACCTCGAAGGGGATGATTGCGAAGG
ATGAACTTAAAAACGAACAGGCAAAAGCTGCCGGCGTACTGAAGGATATCCCGCAGACGCGCTTCAGTCA
GAACCCAATCGAATTTCAGCTTGAAGGTTTGAAGATCACGCATGACGCGATGCTGTGGCGCCTGATTGGT
ATGCTTCAGGGGGATGATGAATCAGGAATGGGGCTTCTGGTTGATGTCCTCGATGTCAAACACGCTGGCG
CAATGATGCGTCAGATGCTGTTCCGGAATTCAACATCAGAAAACTGGTACCCTCGCACGCCGTTTGACCA
AAATCTGCGAATTTATGGCGCCCCACGGAAAGACAATATCGACTCCGTGCTGCCGCCGCGGCTGAATATC
CAGATCATGGAAGGGGAACTGGAAGAAGATGGTGGCCTGATTTACTGTGATGGTAAGTATTACGGCTCTG
TTGCCCTTGAGTTACCACCACTTCACCCTGTCAAATTTAAGCAGTTATTCAACGCGATTAACCGGAAAAT
CCCGTACCGGATAAAATATGACTTTATAGGCGGGGGCAAAAAAGCACTGTTCTGGCCATCAGTAATCATA
TCTTTCCTTCGTTTCATTCCCTCACTCGGTAATATCGCGCGTGATATGGATTATGTCCGGGCCCAGAGCG
AAACCGATCCAACGGCTATCATGGCCATCAACTTTGCCACCTGGGGCGACACTAAGGATGAAGCCAAACG
CAACCTGGCGGCTTTAACTAAGGCGATTGAAGGCTGGGGTGTATCAGGTGTGTCCAAGACATATGGCAAT
CCAGGTAGCGCACTGATTGCATCCGTTCCGGGGCTGACGACGGCCACACCTGGCTCATTGCATTATCCGC
CGTTGAGTGAAGGCTTGCGGATGTTACCTTTTGAACGTCCGGCCAGTCCCTGGCATGGTAAAGGCAATAT
CAACTTCATCACGCTCGATGGCAAGCTGTTCCCCTATCAAATCGCCAGTCCCCTGCAGGAGAAATTTACC
GATGTCATCACCGGTGTTCCTGGTTCCGGTAAAAGCGTGCTGGCCAACCGCCTTAACCTGAGTTCGATTT
ACCGGGCTGATAAAAAACTGCCTTATCTGACCATCATTGATAAGGGCTACAGTGCAAAAGGTATCGCCGA
TCTGATTAGCGCTGAGCTGCCGTCAGAGAAACGTCACCAGATTGCCAGTATCACCCTGAACAATGACGAA
TCGCACTGTATTAACATCTGCGATACGCAGTTAGGTTCAAGGTATCTGACGCAGTTTGAGGAAGTATTCT
TAAAGCAGATGCTTAACGCATTCTGTATTGATCCGGCAATTGGCCAGCCGCCAGATGCAATGAGCGTTGG
CCAAATCGTCAGTAAGGTTGTATCAAACGTATACAAAGCAAAAGCGCATTCAAGTGCTAACTTGTTTAAG
TATAACGACCCGGTGATTAATGAAGCTCTGAAAGAATCAGGTCTGGATAAAGAGCTTGGTGAAGACTGGT
TTGAAAGAGCTACATGGTGGGAAGTCGTTGATAAGCTGTTTGCCAAAAAATATCTTCATGCTGCGACGGT
TGCTCAGCGTTATGCTGTGCCAACCATTCACGATTTTATTGCTGAACTACAAACTGAATCATTTAAAAAC
CAATACGCTGACGTAAAAGTTAATGGGAGTGAGCCTGTAGTAGGCTTCGTTGCACGTTGCTTCCAGGCTG
CTGCAGCTGAGTATGCCATTTTCTCAGGGATAACGGTTTATGATTTCAGCCCGGAGACTCGCATTGCGAT
CCTGGACATGCAAAACGTCCTCGGTGACAGAACGACACCTGCAGGTAAGCTCAAGTCCGGCATTATGTAT
CTTTTTGCGCGCCAGATGGCTGTGCGTAACTACTACCTGCCTCAGTCCGCAGAAACCTTCATTCCTGCTT
TACCGGAGCAGTACAGGGCATATCACCAGGCGCGCATCAGGGAGCTTTCAGAAGAGGTTAAACATACCTT
TTATGATGAGTGTCATAACTTTGCCGGCATCGACTTTATTCAAAATGCGCTGAACACCGCTGACCTTGAA
GATCGTAAATTCAACGTCCGTACTGCCTTCTCGTCTCAGTATCTGAGCCATATGCCTTCGAGTGTGCTTA
AAACCATGAACAGCCTGTTTATGATGCGCCTGACGGAAGGGGATGAAGAGTATCTGAAGCAATTAGAGAT
CAACATCCCGGCCGATATCCTGCGTCGTTTCAGACAGCTTCCGCAAGGGGTTTATCCGGACGGAAGTGGT
ACTGCATTCCTCGGTATTTTTAAAACAAAACGTGGTCTTATTTGCCACATTCTGAAAAACACATTAGGAC
CAAAACTGCTTTGGGCTTTGAACTCATCTGCAAAAGATAGAGCGCTCAGAGATGTGCTTTATGAAGAGCT
GGGAACGAAAAAAGCAAGGGAAGAATTAGCAAATAGATTCCCTATGGGAAGTGCATCAAGTATCATTGAT
GAAATGGTGGTCAATCAGGGTGGTGAGCGTGATTCTGAAGAAGAATCACAAACTATGGCGATGAAGCTCG
CTAAAGAAATCATTTCTGATGTGAGAAGGGGATTCAGATGA
 Primer design