SecReT4
Protein ID: 217969371
T4SS name [ID]Tfc [714]
Gene symbol-
Locus tagTmz1t_0943
StrainThauera sp. MZ1T
Repliconchromosome [GenBank: NC_011662] [Browse all T4SS(s) in this replicon]
Location [Strand]1034012..1035418 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 468 a.a.     [Download]
>gi|217969371|ref|YP_002354605.1| hypothetical protein Tmz1t_0943 [Thauera sp. MZ1T]
MNASLPDFLHRAKSPLRATQLVAAITLVVGVAWAQTRIDPNGVNVSGSVIGDDVLYSIGGGRAVSMGGAG
NMQSIGVGVGWNSNLICGDMSITTTLQNQLNGITNGFQTIMSNVIQNATSAVASLPALIIQRADPGLYNL
LTNGILQARLDFDRSKMTCRAIANRMADMAGGQAGWDQLAEGMALRDAVSSTDAVSAIEQAESNKGNNGV
PWVGGGNAGGSGQSSIKVVGDVTRAGYNLLNGRSATDSSSIAPSACGNRLTCQTWSSPQAASAWAIRVLG
EREQRTCENCTKTQTTPGVGLTPMIQEEYETKLQVLQELVTGARPTTLANLDAAGSSSLPITRGVIEALR
DEPDQDLLGKRLASEAALSSVLEKALLLQRTLLTGKKEPNVAANELAVQAVDQENSALEQEINNLKTELE
LRRTLAGNSAMAIIQRHSTRAAGSRGVFEGDTTRDRLREVQKPRSGTP
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|237653092|ref|NC_011662.2|:c1035418-1034012 Thauera sp. MZ1T chromosome, complete genome
ATGAACGCCTCCCTCCCTGACTTCCTGCACCGCGCGAAGTCGCCCCTGCGGGCCACGCAGCTCGTGGCGG
CCATCACGCTGGTCGTCGGCGTCGCCTGGGCGCAGACCCGCATCGACCCCAATGGCGTGAACGTCAGCGG
CAGCGTGATCGGCGACGACGTGCTCTACAGCATCGGCGGCGGCCGGGCCGTGTCGATGGGTGGTGCCGGC
AACATGCAGAGCATCGGCGTCGGCGTCGGCTGGAACAGCAACCTGATCTGCGGCGACATGAGTATCACCA
CGACACTGCAGAACCAGCTCAACGGCATCACCAACGGCTTCCAGACGATCATGAGCAACGTGATCCAGAA
CGCCACCAGCGCCGTGGCCTCGCTGCCGGCGCTGATCATCCAGCGCGCCGACCCGGGGCTCTACAACCTG
CTGACCAACGGCATCCTCCAGGCGCGCCTGGACTTCGACCGCTCGAAGATGACCTGCCGGGCCATCGCCA
ATCGCATGGCGGATATGGCCGGCGGCCAGGCCGGCTGGGACCAGCTCGCCGAGGGGATGGCGCTGCGGGA
TGCGGTCAGCAGCACCGATGCCGTCTCCGCCATCGAGCAGGCCGAGTCCAACAAAGGAAACAACGGCGTG
CCATGGGTCGGCGGCGGCAACGCGGGCGGCTCCGGTCAGAGTTCGATCAAGGTGGTCGGCGACGTGACGC
GCGCGGGCTACAACCTGCTCAACGGGCGCAGCGCCACCGATAGCTCGTCGATCGCACCCAGCGCCTGCGG
CAACCGCCTGACCTGCCAAACCTGGTCCTCGCCGCAGGCGGCCTCGGCCTGGGCGATCCGCGTGCTGGGC
GAGCGTGAGCAGCGCACCTGCGAAAACTGCACGAAGACCCAGACCACGCCTGGCGTCGGGCTGACGCCAA
TGATCCAGGAAGAGTACGAAACCAAGCTGCAGGTGCTGCAGGAACTGGTGACGGGCGCCCGGCCGACGAC
GCTGGCCAATCTCGACGCGGCCGGCAGCAGCTCGCTGCCGATCACCCGCGGCGTGATCGAGGCCTTGCGG
GACGAACCCGACCAGGACCTGCTGGGCAAGCGCCTCGCGTCCGAGGCGGCGCTGTCCAGCGTGCTGGAGA
AGGCCCTGCTGCTGCAACGCACGTTGCTGACCGGCAAGAAGGAGCCGAACGTCGCTGCCAACGAGCTGGC
CGTGCAGGCGGTCGACCAGGAGAACAGCGCGCTGGAGCAGGAGATCAACAACCTCAAGACCGAACTGGAG
CTGCGCCGCACGCTGGCCGGCAACTCGGCGATGGCGATCATCCAGCGCCACAGCACCCGCGCGGCCGGCT
CGCGCGGCGTCTTCGAGGGCGACACCACACGCGACCGTCTGCGGGAAGTCCAGAAGCCGCGGAGCGGTAC
GCCATGA
 Primer design