SecReT4
Protein ID: 217969381
T4SS name [ID]Tfc [714]
Gene symbol-
Locus tagTmz1t_0953
StrainThauera sp. MZ1T
Repliconchromosome [GenBank: NC_011662] [Browse all T4SS(s) in this replicon]
Location [Strand]1044746..1045156 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 5.1e-48, Aligned region: 12..133
Protein Sequence: 136 a.a.     [Download]
>gi|217969381|ref|YP_002354615.1| hypothetical protein Tmz1t_0953 [Thauera sp. MZ1T]
MAVPSETPRDTLVAFLPHRLNRQPVVVRGLTADELWICAGLSAAAGFALGLPLAWLTHSIAMVPTLIVAG
IALGVFVGGGFLRAQKRGRPDTWLYRQLQWRLALRHPALAALLCGKRLITRSGCWTTRRNTDRGAP
 
Nucleotide Sequence: 411 bp     [Download]
>gi|237653092|ref|NC_011662.2|:c1045156-1044746 Thauera sp. MZ1T chromosome, complete genome
ATGGCCGTCCCTTCGGAGACCCCGCGCGACACGCTGGTGGCCTTCCTGCCGCACCGGCTGAACCGCCAGC
CGGTGGTCGTGCGCGGGCTGACCGCCGACGAGTTGTGGATCTGCGCCGGCCTGTCTGCCGCAGCCGGGTT
CGCGCTCGGCCTGCCGCTGGCCTGGCTCACGCACAGCATCGCCATGGTGCCCACGCTGATCGTCGCCGGC
ATCGCGCTGGGCGTCTTCGTCGGCGGCGGCTTCCTGCGCGCGCAGAAGCGCGGCCGGCCCGACACCTGGC
TGTACCGGCAGCTCCAGTGGCGGTTGGCCCTGCGGCACCCGGCGCTGGCGGCGCTCCTGTGCGGCAAGCG
CCTCATCACCCGCTCGGGCTGCTGGACGACCCGGCGCAACACCGATCGAGGTGCGCCATGA
 Primer design