SecReT4
Protein ID: 217969384
T4SS name [ID]Tfc [714]
Gene symbol-
Locus tagTmz1t_0956
StrainThauera sp. MZ1T
Repliconchromosome [GenBank: NC_011662] [Browse all T4SS(s) in this replicon]
Location [Strand]1045796..1046161 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.2e-30, Aligned region: 31..108
Protein Sequence: 121 a.a.     [Download]
>gi|217969384|ref|YP_002354618.1| hypothetical protein Tmz1t_0956 [Thauera sp. MZ1T]
MGQTNRRTSAWPALAVVLAVSFSALQPAVAADSLASEREQLAALTRQLDLLDRLAEHAANTSPQARARYH
FDYARLRADLKRVRAGLQDYLVPQRAQPRDPVPLAGDYVRRDRADDEEPSP
 
Nucleotide Sequence: 366 bp     [Download]
>gi|237653092|ref|NC_011662.2|:c1046161-1045796 Thauera sp. MZ1T chromosome, complete genome
ATGGGACAGACCAACCGCCGCACATCCGCATGGCCTGCGCTTGCCGTGGTGTTGGCTGTGTCGTTCTCGG
CGCTGCAGCCTGCCGTCGCTGCCGACAGCCTCGCCTCGGAGCGTGAGCAGCTCGCCGCGCTCACCCGCCA
ACTCGACCTGCTCGACCGCCTGGCCGAGCACGCCGCCAACACCTCGCCGCAGGCGCGCGCCCGCTACCAC
TTCGACTACGCCCGGCTGCGCGCAGACCTGAAGCGCGTTCGCGCCGGCCTGCAGGACTACCTCGTGCCCC
AGCGCGCCCAGCCGCGCGATCCCGTCCCGCTGGCCGGCGATTACGTCCGGCGCGATCGCGCCGACGACGA
GGAGCCGTCGCCATGA
 Primer design