SecReT4
Protein ID: 217969390
T4SS name [ID]Tfc [714]
Gene symbol-
Locus tagTmz1t_0962
StrainThauera sp. MZ1T
Repliconchromosome [GenBank: NC_011662] [Browse all T4SS(s) in this replicon]
Location [Strand]1058046..1058795 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 9.3e-72, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|217969390|ref|YP_002354624.1| hypothetical protein Tmz1t_0962 [Thauera sp. MZ1T]
MSDPAVAAQRQQQRQQGLIAGLVTLPFRFFGVLCGALLLCILIECVGMHFFWPEQGWRHAQGMLHYELDQ
LSTHFTRSALLQEPGRTAHRLVEQGYDWLFVKSGLLDWIRDASAQASAGSHRPTKDFRYYLGLVSVNVES
YLIAAAYTTLVFLVRLLVLCLTLPLFLMAAFVGLVDGLVRRDIRRFGAGRESGFIYHRARASLIPLAVLP
WVTYLALPVSVNPLLILLPSAALLGVAVCIAAATFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|237653092|ref|NC_011662.2|:c1058795-1058046 Thauera sp. MZ1T chromosome, complete genome
ATGAGCGATCCGGCCGTCGCGGCCCAGCGCCAGCAGCAACGACAGCAGGGGCTGATCGCCGGCCTGGTCA
CGTTGCCGTTCCGCTTCTTCGGCGTGCTGTGCGGCGCGCTGCTGCTGTGCATCCTGATCGAATGCGTCGG
CATGCACTTCTTCTGGCCCGAGCAGGGCTGGCGCCACGCGCAGGGCATGCTGCACTACGAGCTGGATCAG
CTCTCCACGCATTTCACGCGCAGCGCGCTGTTGCAGGAGCCGGGGCGCACCGCGCACCGGCTGGTCGAGC
AGGGCTACGACTGGCTGTTCGTGAAAAGCGGTCTGCTGGACTGGATACGCGACGCCTCGGCGCAGGCCAG
CGCCGGCAGCCATCGCCCGACCAAGGACTTCCGCTACTACCTGGGTCTGGTCTCCGTGAACGTGGAGAGC
TACCTGATCGCGGCGGCCTACACGACACTGGTCTTCCTCGTGCGGCTGCTGGTGCTGTGCCTGACCTTGC
CGCTGTTCCTGATGGCCGCCTTCGTCGGGCTGGTGGATGGCCTGGTGCGCCGGGACATCCGCCGCTTCGG
CGCGGGACGCGAGTCGGGGTTCATCTATCACCGCGCCAGGGCCAGCCTGATCCCGCTGGCCGTGCTGCCG
TGGGTGACTTACCTGGCACTGCCGGTCAGCGTGAACCCGCTGCTGATCCTGCTGCCCAGCGCCGCACTGC
TCGGCGTGGCGGTGTGCATTGCGGCGGCGACGTTTAAGAAGTACCTGTGA
 Primer design