SecReT4
Protein ID: 217969393
T4SS name [ID]Tfc [714]
Gene symbol-
Locus tagTmz1t_0965
StrainThauera sp. MZ1T
Repliconchromosome [GenBank: NC_011662] [Browse all T4SS(s) in this replicon]
Location [Strand]1061487..1062107 [-]
Productlytic transglycosylase
Component typeTfc4
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 206 a.a.     [Download]
>gi|217969393|ref|YP_002354627.1| lytic transglycosylase [Thauera sp. MZ1T]
MAAAIGTPGRERRPSRVAIRLIGAALLLASGGWSLAALARDVPPPAYQMAAHRADVPAAVLYAVALQESG
AMLRGRLIPWPWTLNVAGTPQRYATRAEACAGLHRALTHTPANRIDAGLGQVNLGYHTHRYTQPCELLDP
YRNLAIAAEILREQHTPGEDWLLAIGRYHRPAGGAPAARYRRSVHRHLTRVLDPGVPVPTLQATTP
 
Nucleotide Sequence: 621 bp     [Download]
>gi|237653092|ref|NC_011662.2|:c1062107-1061487 Thauera sp. MZ1T chromosome, complete genome
ATGGCAGCGGCAATAGGTACTCCGGGCCGGGAGCGTCGGCCGTCCCGCGTCGCCATCCGCTTGATCGGTG
CCGCGCTGCTGCTCGCGAGCGGGGGCTGGTCGTTGGCGGCGCTGGCGCGTGATGTGCCACCTCCGGCCTA
TCAAATGGCGGCGCATCGTGCAGACGTGCCGGCGGCGGTGCTGTACGCGGTGGCCTTGCAGGAGAGCGGC
GCCATGCTGCGCGGGCGCCTGATCCCCTGGCCGTGGACGCTCAACGTCGCCGGCACGCCACAGCGCTACG
CCACCCGCGCCGAGGCCTGCGCGGGGCTGCACCGTGCGCTCACCCACACGCCGGCCAATCGCATCGACGC
CGGCCTCGGCCAGGTCAATCTCGGCTACCACACGCATCGCTACACGCAGCCCTGCGAGCTGCTGGACCCA
TACCGCAACCTCGCCATCGCCGCGGAAATCCTGCGCGAACAGCACACGCCGGGCGAGGACTGGCTGCTTG
CCATCGGCCGCTACCACCGGCCCGCCGGCGGGGCACCTGCGGCGCGCTACCGGCGCAGTGTGCATCGGCA
CCTGACCCGCGTGCTCGACCCCGGCGTTCCCGTTCCAACCCTCCAGGCCACCACGCCATGA
 Primer design