SecReT4
Protein ID: 217975586
T4SS name [ID]Tra_F [535]
Gene symbol-
Locus tagSbal223_4373
StrainShewanella baltica OS223
Repliconplasmid pS22301 [GenBank: NC_011664] [Browse all T4SS(s) in this replicon]
Location [Strand]40052..40354 [+]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDB8EFN6
KEGG IDsbp:Sbal223_4373
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 9.2e-33, Aligned region: 7..99
Protein Sequence: 100 a.a.     [Download]
>gi|217975586|ref|YP_002360256.1| type IV conjugative transfer system protein TraL [Shewanella baltica OS223]
MDNPTQFFSIPKHLNNTPTLLGFAMDEIVPALMFFAVLFMMDHALIGMVLASSWFLGMRRMKSQYGMSVL
RLTAYWYAPAEFSASFLKRTPAACRRYWLR
 
Nucleotide Sequence: 303 bp     [Download]
>gi|217975547|ref|NC_011664.1|:40052-40354 Shewanella baltica OS223 plasmid pS22301, complete sequence
GTGGATAATCCCACTCAGTTTTTTAGCATCCCTAAACACCTTAATAACACCCCTACGCTATTAGGGTTCG
CTATGGATGAAATAGTCCCTGCCTTAATGTTTTTTGCCGTGTTATTCATGATGGATCACGCGCTCATTGG
CATGGTACTAGCCTCTTCATGGTTTTTAGGGATGCGCAGAATGAAATCGCAATACGGCATGAGCGTATTA
CGCCTCACCGCTTATTGGTACGCCCCTGCAGAATTTAGCGCTTCATTTTTAAAACGAACACCTGCGGCAT
GTCGCCGCTACTGGTTACGTTAA
 Primer design