SecReT4
Protein ID: 217975597
T4SS name [ID]Tra_F [535]
Gene symbol-
Locus tagSbal223_4384
StrainShewanella baltica OS223
Repliconplasmid pS22301 [GenBank: NC_011664] [Browse all T4SS(s) in this replicon]
Location [Strand]51003..51878 [+]
Producttype-F conjugative transfer system pilin assembly protein TraF
Component typeTraF_F
UniProt IDB8EFP7
KEGG IDsbp:Sbal223_4384
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3.2e-69, Aligned region: 63..281
Protein Sequence: 291 a.a.     [Download]
>gi|217975597|ref|YP_002360267.1| type-F conjugative transfer system pilin assembly protein TraF [Shewanella baltica OS223]
MRTLLNNRLQHAAAVPFFRWSSRAPLAWLSTKKGDAVVNKRSALVLLILTTFCHGANATDAQGWRWYNEP
TAPKKQAPKKAETPSVTLTRTQTLTPTEQMDWFHSYYQDTLNDAAINSQDSEKVERAMLLNQYVSNKSSE
FGMTFKKVLLDNPELSYTKDRPTEQAARSTYLSLERNKKMRAVRTLADAGWGLFFVYKGSEEIDIALAPS
VQQFATQHGIELLGVTLDGVALPAIVQNRQNDQHINVPFSPALVLVNPGTGEMKPLAYGFISQDDLLGRF
LNVATDFAPDF
 
Nucleotide Sequence: 876 bp     [Download]
>gi|217975547|ref|NC_011664.1|:51003-51878 Shewanella baltica OS223 plasmid pS22301, complete sequence
ATGAGGACGTTGTTAAATAACCGCTTGCAACATGCCGCCGCAGTGCCTTTTTTTCGGTGGTCAAGCCGCG
CGCCGTTGGCGTGGTTGTCCACAAAAAAAGGGGATGCGGTGGTCAACAAGCGCAGCGCGTTAGTGCTCCT
TATACTGACAACGTTTTGCCACGGCGCAAACGCCACGGATGCACAAGGCTGGCGCTGGTATAACGAACCG
ACTGCCCCCAAGAAGCAAGCGCCTAAAAAGGCCGAAACGCCAAGCGTCACACTCACGCGCACCCAAACCC
TGACGCCCACCGAGCAGATGGATTGGTTTCACAGCTACTACCAAGACACGCTCAATGACGCGGCGATAAA
CAGCCAAGACAGCGAGAAAGTGGAAAGGGCCATGCTGCTTAATCAGTACGTCAGCAATAAATCCTCAGAG
TTTGGCATGACCTTCAAAAAGGTCCTGCTGGATAACCCTGAGCTGTCTTACACCAAAGACAGACCGACGG
AACAAGCGGCAAGAAGTACGTATTTATCATTAGAGCGCAACAAGAAGATGCGCGCAGTACGCACCCTTGC
AGATGCGGGATGGGGCCTGTTCTTTGTCTACAAAGGCAGTGAAGAAATTGATATTGCGCTGGCGCCCAGC
GTGCAGCAGTTCGCAACGCAACATGGCATTGAGCTACTTGGCGTCACGCTGGATGGTGTAGCACTGCCAG
CCATCGTACAGAACCGCCAAAACGACCAGCACATAAACGTCCCGTTTAGTCCCGCACTCGTGTTAGTTAA
TCCTGGCACGGGGGAAATGAAACCGCTCGCTTATGGCTTTATCTCTCAAGACGATTTACTTGGCCGCTTC
CTGAACGTGGCCACCGATTTCGCCCCTGACTTTTAA
 Primer design