SecReT4
Protein ID: 217975714
T4SS name [ID]Tra_F [534]
Gene symbol-
Locus tagSbal223_4497
StrainShewanella baltica OS223
Repliconplasmid pS22303 [GenBank: NC_011665] [Browse all T4SS(s) in this replicon]
Location [Strand]19090..19392 [+]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDB8EG10
KEGG IDsbp:Sbal223_4497
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 6.6e-33, Aligned region: 7..99
Protein Sequence: 100 a.a.     [Download]
>gi|217975714|ref|YP_002360313.1| type IV conjugative transfer system protein TraL [Shewanella baltica OS223]
MDNPTQFFSIPKHLNNTPTLLGFAMDELVPALVFFAVLFMMDHALIGMALASSWFLGMRRMKSQYGMSVL
RLTAYWYAPAEFSASFLKRTPAACRRYWLR
 
Nucleotide Sequence: 303 bp     [Download]
>gi|217975697|ref|NC_011665.1|:19090-19392 Shewanella baltica OS223 plasmid pS22303, complete sequence
GTGGATAATCCCACTCAGTTTTTTAGCATCCCTAAACACCTCAATAACACCCCTACGTTATTAGGGTTTG
CGATGGATGAACTTGTTCCTGCCTTAGTGTTTTTTGCCGTGTTATTCATGATGGATCACGCGCTCATTGG
CATGGCGCTAGCCTCTTCATGGTTTTTAGGGATGCGCAGAATGAAATCGCAATACGGCATGAGCGTATTA
CGCCTCACCGCTTATTGGTACGCCCCTGCAGAATTTAGCGCTTCATTTTTAAAACGAACTCCTGCGGCAT
GTCGCCGCTACTGGTTACGTTAA
 Primer design