SecReT4
Protein ID: 217975725
T4SS name [ID]Tra_F [534]
Gene symbol-
Locus tagSbal223_4508
StrainShewanella baltica OS223
Repliconplasmid pS22303 [GenBank: NC_011665] [Browse all T4SS(s) in this replicon]
Location [Strand]30041..30916 [+]
Producttype-F conjugative transfer system pilin assembly protein TraF
Component typeTraF_F
UniProt IDB8EG21
KEGG IDsbp:Sbal223_4508
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 8.8e-69, Aligned region: 63..281
Protein Sequence: 291 a.a.     [Download]
>gi|217975725|ref|YP_002360324.1| type-F conjugative transfer system pilin assembly protein TraF [Shewanella baltica OS223]
MMTWLNDRLQHAAVSPFFRWSSRAPLAWLSTKKGDAVVNKRSALVLLMLTTFCLGANATDAQGWRWYNEP
TAPKKQAPKKAETPSVTLTRTQTLTPTEQMDWFHSYYQDTLNDAAINSQDSKKVERAMLLNQYVSNKSSE
FGMTFKKVLLDNPELSYTKDRPTEQAARSTYLSLERNKKMRAVRSLADAGWGLFFVYKGQEEMDIALAPS
VQQFATEHGIELLGVTLDGVALPAIVQNRQNDQHINVPFSPALVLVNPGTGEMKPLAYGFISQDDLLGRF
LNVATDFAPDF
 
Nucleotide Sequence: 876 bp     [Download]
>gi|217975697|ref|NC_011665.1|:30041-30916 Shewanella baltica OS223 plasmid pS22303, complete sequence
ATGATGACGTGGTTAAATGACCGCTTACAACATGCCGCAGTATCTCCTTTTTTTCGGTGGTCAAGCCGCG
CGCCGTTGGCGTGGTTGTCCACAAAAAAAGGGGATGCGGTGGTCAACAAGCGCAGCGCGTTAGTGCTCCT
TATGCTGACAACGTTTTGCCTCGGCGCAAACGCCACGGATGCACAAGGCTGGCGCTGGTATAACGAACCG
ACCGCCCCCAAGAAGCAAGCACCTAAAAAGGCCGAAACGCCAAGCGTCACACTCACGCGCACCCAAACAC
TGACGCCCACAGAGCAGATGGATTGGTTTCACAGCTACTACCAAGACACGCTCAATGACGCGGCGATAAA
CAGCCAAGACAGCAAGAAAGTGGAAAGGGCCATGCTGCTTAATCAGTACGTCAGCAATAAATCCTCAGAG
TTCGGCATGACCTTTAAAAAGGTCCTGCTAGATAACCCTGAGCTGTCTTACACCAAAGATAGACCGACGG
AACAAGCGGCAAGAAGCACCTATTTATCATTAGAGCGCAACAAGAAGATGCGCGCAGTACGCAGCCTTGC
CGATGCGGGATGGGGGCTGTTCTTTGTCTACAAAGGCCAAGAAGAAATGGATATTGCGCTAGCGCCCAGC
GTGCAGCAGTTCGCTACTGAGCATGGCATTGAGCTACTTGGCGTCACGCTCGATGGTGTCGCACTGCCAG
CCATCGTGCAGAACCGCCAAAACGACCAGCACATAAACGTCCCGTTTAGTCCTGCACTCGTGTTAGTTAA
TCCTGGCACGGGGGAAATGAAACCGCTCGCGTATGGCTTTATCTCTCAAGACGATTTACTGGGCCGCTTC
CTGAACGTGGCCACCGATTTCGCCCCTGACTTTTAA
 Primer design