SecReT4
Protein ID: 217980268
T4SS name [ID]Tra_F [529]
Gene symbol-
Locus tagSbal223_4421
StrainShewanella baltica OS223
Repliconplasmid pS22302 [GenBank: NC_011668] [Browse all T4SS(s) in this replicon]
Location [Strand]3829..9789 [-]
Productconjugative transfer relaxase protein TraI
Component typeTraI_F
UniProt IDB8EFT6
KEGG IDsbp:Sbal223_4421
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 2.5e-82, Aligned region: 9..320
AAA_30 [PF13604], Evalue: 8.4e-50, Aligned region: 480..598
AAA_30 [PF13604], Evalue: 8.4e-50, Aligned region: 1041..1237
Toprim_3 [PF13362], Evalue: 3.4e-15, Aligned region: 1809..1887
Protein Sequence: 1986 a.a.     [Download]
>gi|217980268|ref|YP_002364244.1| conjugative transfer relaxase protein TraI [Shewanella baltica OS223]
MLSISPIASSAGGAASYYLSEEKNLNLPDVSLEKAADAKEGETNYYLKEQSAEPNTQWFGKLAEQEGMLG
KPVEEHQLKEVLAGSLNDQTLKTQNSNARNGFDFTFSAPKSVSLLALVGGDKRLMTAHDDAVKFALSHIE
KDAAQARQTNPDTKATSFENTGNLLFAMVRHKTSREEDPQLHTHSLTANMTKDSEGTLRALASSFKQKGG
IINGTGERVYNHQKYYTSLYQSALARSVEQAGYQTRSLGNNLFEVEGVPQSLLDTFSTRSQQINEQTQSL
GLDSQAARDVAAKDTRKSKAYTSEATLFEQWKNKANNSGFNLTSFVTDSMSRETSLNALALKPAAIDAVS
RAIEHASNTQNRFNYAKLVESATLEFTRGQKLDALDIKLALDKHIEDGALIPLDKESATFTSAAHIKAET
NLLESIKPKTANMRQVVDTNTLQGKGLNADNQKKVSELFASTKQVNLVNVFGSSEQLATALLNVGEANGK
RIHIITPDMKSKLQTSERVQRDSSTVVKWIMNHFKPDHTHTLSSFTKTANNTNRDILVVENANKLGLNDF
NALLAQAKAGNSKVILLNHANAKQGMKAGNAIEVLKKGNVNESNWVATKQSNTAMRLHESKDSDRVNLIA
KTYAQLPEKQHTQVIAGTHKDVKQLNSAIRAELQNQGDVSRLGLNIPTLNPVFLSAQQREVVGQYTKGMV
LTQWQKVGGRNQQQQLTVDSVNRDNNTLTLIDKNGKASEINPSSKAFKAAEYVIAKPDNLHIANGDKLIM
ATNHQDSGLSKQIYTINALSKEWVTLKDESGKQHSVKASALHHAPLNHGYATTPSNASPNASHHIVNIKA
YSASKEWLHDTLTQGIKHIDIFTDKAQQFDDRLEKSEVKPSSISRIMQAADMPEKFVNSQTTALLTQDVT
AALNAIGAQHQDKGLIHNAVDFAIQHISEKEAGYSQKELIVNAIKYAFEEKGTSITQHEIINTLQHMATN
STDKGAPSLLSAEYHDGTRWTTQAAIDTEVRILDRLQAGKDQLAPLTSVEHAAQVLSQNQNLTDGQKDAT
LLITTTKDRFVGVQGLAGTGKSTMLETGIDLVKQSESILNTQPNKTPTQFIGLAPTHAAVNELKDKNVES
QTVQSLLSNFLSQDAKPDQYANTVFLLDESSMTSNAQMDKFTHLIETTGARAVFLGDTKQLTSQEAGKPF
ELALNKGAINSVTMKDIVRQQNSTLLSAVHNIVDRQGESAIDKIQQQLPFDQYTAPTANDAVTPEKQATA
NINQSLNIISTLQPLTDNPKKNQQLATEALPATVALEYLARTPKARENTLIIAYTNKERDDITHEIRQGL
QQQKSLSNEQFTVPRLRGVHASKAELATMLPYQQGLILTTSKDSYFEIMKVDKRNNMLTLADMKTGEEKH
FFPKNHGHKFTNLWAKSEQPLAEGDSIMLRKSDIDREMQGNKTYTVSRIDDKQMQLKSTDNHTLTLSTKE
LKDAHWDYAYTRTADMAQGATYENVITAIKGQGALTNVRRAYIDITRASKHVKIITDNPQKMMLSWVNND
PNKVSALETRDKYYPEHTPLFNDKPLPQENPKYLDVNGYVDLKLMATELNAKLPAYSESLATQLLGEPNH
DKSDKDNLTFGKEGSLTLTTTGQYRGYFKDWKTGDKGTLINLIMVAEKCSYKDALYKADKMMNEPDKYNL
VKNPQHDELTHAIPVKQSQLEARAKQYFNEAKPIENSLAQTYLNKQGIDVKQHENLRFHDAVYSSEKRGT
FPALIANITNDKDETKAVEITYLDKSSGDIAALKINKRILGSKSGNSTTINKGNNSDYSIVAVGVENALK
INADNKNGADVIALNNNNDTKTFNTNELRENVIVVLDTSNSQDTAKLASDLTDKFSKENIHAVIIEPNLI
PDGLNKVETTKQLVNEAVYSITTKDNTLSKAIQSLSNDIAGTKNITMKDDSTNVATNKIKHDEHYQHLAM
DSHRSPTKEHSPNIDNPKLDIGEKTM
 
Nucleotide Sequence: 5961 bp     [Download]
>gi|217980264|ref|NC_011668.1|:c9789-3829 Shewanella baltica OS223 plasmid pS22302, complete sequence
ATGCTTTCTATCAGTCCCATTGCGTCGAGCGCTGGCGGCGCGGCCAGCTACTACCTCAGTGAAGAAAAGA
ACCTCAATTTGCCTGACGTGTCGTTAGAAAAAGCAGCGGACGCCAAAGAAGGGGAAACCAACTATTACTT
GAAAGAGCAAAGCGCCGAGCCCAATACCCAATGGTTTGGCAAACTGGCAGAGCAAGAGGGAATGTTAGGT
AAGCCCGTTGAAGAACATCAACTCAAAGAGGTGTTAGCCGGTAGCCTGAACGACCAAACGCTTAAAACCC
AAAACAGCAACGCCCGCAACGGTTTTGACTTTACCTTTTCGGCGCCTAAATCCGTCAGTTTGCTTGCACT
CGTGGGCGGCGATAAACGCTTAATGACAGCGCACGATGACGCGGTAAAATTCGCGTTATCGCATATCGAG
AAAGATGCGGCGCAGGCCAGACAAACCAACCCTGATACCAAAGCGACCTCTTTTGAAAACACGGGCAATT
TGCTGTTTGCAATGGTACGCCACAAAACTAGCCGTGAAGAAGATCCGCAGCTGCATACCCACTCACTCAC
CGCCAACATGACCAAGGACAGCGAGGGCACATTGCGCGCGCTGGCAAGCAGCTTTAAACAAAAAGGCGGC
ATCATCAATGGCACGGGTGAGCGGGTTTATAACCATCAAAAATACTACACCTCGCTCTATCAAAGCGCCT
TAGCGCGCAGTGTTGAACAAGCGGGTTATCAAACTCGTTCACTGGGTAATAATTTGTTTGAAGTGGAAGG
TGTCCCGCAGTCCTTACTCGATACCTTTTCAACCCGTAGCCAGCAAATCAACGAACAAACCCAAAGCTTA
GGTTTAGACTCCCAAGCGGCGCGGGATGTGGCCGCAAAGGACACCCGCAAGAGTAAAGCCTATACCAGCG
AAGCCACCTTGTTTGAGCAATGGAAAAACAAAGCCAATAACAGCGGCTTTAACCTGACAAGCTTCGTGAC
GGACAGCATGTCACGAGAAACATCACTCAATGCGTTAGCGCTCAAACCCGCCGCTATCGATGCGGTGAGT
CGTGCGATTGAGCACGCCAGTAACACCCAAAACCGTTTTAATTACGCGAAATTAGTGGAATCAGCCACGC
TTGAATTTACGCGCGGCCAGAAGCTCGATGCGCTCGATATTAAATTGGCACTCGATAAGCACATTGAAGA
TGGCGCACTCATTCCGCTTGATAAAGAGTCTGCGACCTTTACCAGCGCCGCCCACATCAAAGCCGAAACT
AACCTGCTAGAGAGCATCAAGCCAAAAACGGCCAACATGCGCCAAGTGGTCGATACCAACACGCTTCAAG
GCAAAGGCTTAAATGCGGACAACCAAAAGAAAGTCTCTGAACTGTTCGCCAGTACCAAACAAGTTAACCT
AGTGAACGTCTTTGGTAGCAGTGAACAGCTCGCGACCGCCCTGCTCAATGTCGGTGAGGCCAACGGTAAA
CGTATTCACATCATTACCCCTGACATGAAAAGCAAACTGCAAACCAGTGAACGAGTGCAACGCGATTCAT
CGACTGTGGTGAAGTGGATAATGAACCACTTCAAACCCGACCACACCCATACACTCAGCAGCTTTACTAA
AACGGCCAACAACACTAACCGCGATATTTTAGTGGTTGAGAACGCCAATAAACTCGGCCTTAACGACTTT
AATGCCCTGCTCGCGCAAGCCAAAGCGGGTAACAGTAAAGTGATTTTGCTCAATCACGCCAATGCCAAGC
AAGGCATGAAAGCCGGTAACGCTATCGAGGTACTTAAAAAAGGCAACGTAAACGAAAGCAACTGGGTCGC
CACCAAACAAAGCAACACAGCCATGCGACTGCATGAAAGCAAAGACAGTGACAGGGTTAACCTGATTGCA
AAAACTTACGCGCAACTGCCCGAGAAGCAACACACCCAAGTCATTGCGGGCACCCATAAAGATGTGAAGC
AGCTTAACAGCGCCATTCGCGCAGAACTGCAAAATCAAGGTGATGTATCGCGCCTTGGGCTCAACATCCC
TACCCTTAATCCCGTGTTCTTATCCGCGCAGCAACGGGAAGTCGTCGGCCAGTACACCAAGGGCATGGTA
CTCACCCAATGGCAAAAAGTCGGTGGCCGCAATCAACAGCAGCAATTGACGGTGGACAGTGTAAACCGTG
ATAACAACACCCTCACGCTGATAGACAAAAACGGTAAAGCATCTGAGATTAACCCCAGCAGCAAAGCCTT
TAAAGCCGCAGAGTACGTGATCGCTAAACCGGACAATTTACATATCGCCAACGGCGATAAACTCATCATG
GCCACAAACCATCAAGACAGTGGTTTGAGCAAACAAATTTATACGATCAACGCCCTGTCCAAAGAATGGG
TCACGCTCAAAGACGAAAGCGGCAAACAGCACAGCGTTAAAGCCAGTGCATTGCACCATGCGCCGCTCAA
TCATGGTTACGCCACCACGCCAAGCAATGCCAGCCCTAATGCAAGTCACCACATCGTCAACATTAAAGCC
TATAGCGCCTCAAAAGAGTGGTTACATGACACCCTGACACAAGGCATCAAACACATCGATATATTCACCG
ACAAGGCACAACAATTTGATGACCGATTAGAAAAAAGTGAGGTGAAACCATCCAGTATTTCGCGCATCAT
GCAAGCCGCTGACATGCCAGAAAAGTTCGTGAATAGCCAAACCACGGCCCTGCTCACCCAAGATGTGACC
GCAGCACTGAATGCCATTGGTGCCCAGCATCAAGACAAAGGGCTTATTCACAATGCCGTGGACTTTGCCA
TCCAGCACATTAGCGAGAAAGAAGCCGGTTACTCACAAAAAGAGCTGATTGTTAATGCGATCAAGTACGC
ATTTGAGGAAAAAGGCACCAGCATTACCCAACATGAAATCATCAACACCCTGCAACACATGGCCACGAAC
AGCACGGATAAAGGCGCGCCCTCACTCCTGAGCGCCGAATACCACGACGGCACCCGCTGGACAACCCAAG
CCGCTATCGATACCGAAGTGCGTATTTTAGACAGACTGCAAGCGGGCAAAGATCAACTTGCGCCCCTTAC
CAGCGTTGAACACGCCGCGCAGGTACTCAGTCAAAATCAAAACCTGACCGATGGCCAAAAAGACGCGACC
TTGCTTATCACCACCACCAAAGACCGATTTGTGGGTGTTCAAGGGTTAGCGGGTACGGGTAAATCGACCA
TGCTTGAAACGGGTATCGATCTTGTTAAACAAAGCGAATCCATTCTCAACACACAACCCAATAAGACACC
GACACAATTCATCGGTCTAGCGCCGACACACGCCGCCGTTAACGAACTCAAAGACAAGAACGTCGAAAGC
CAAACGGTGCAATCACTCCTAAGCAACTTTTTAAGCCAAGATGCGAAACCTGACCAATACGCCAACACCG
TGTTCTTGCTCGATGAATCCTCGATGACCAGTAACGCCCAAATGGATAAATTTACCCATTTGATTGAGAC
AACAGGCGCGCGCGCCGTGTTCTTGGGTGACACTAAACAGTTAACGTCCCAAGAAGCGGGTAAACCTTTT
GAACTCGCGTTAAACAAAGGCGCAATCAATAGCGTCACCATGAAAGACATTGTGCGCCAACAGAACAGCA
CACTACTGAGTGCGGTACACAATATTGTCGATCGCCAAGGCGAAAGCGCTATTGATAAAATTCAGCAACA
ATTACCCTTTGACCAATACACCGCGCCCACCGCGAACGACGCGGTAACGCCCGAAAAGCAGGCTACCGCT
AACATCAATCAAAGCTTGAATATCATTTCAACTTTGCAGCCGCTAACTGATAACCCAAAGAAAAACCAGC
AACTTGCGACCGAAGCCCTGCCCGCCACTGTGGCACTGGAATACTTGGCCAGAACACCTAAAGCGCGTGA
AAATACCCTTATCATTGCGTACACCAACAAGGAACGCGACGACATTACCCACGAAATCCGCCAAGGGTTA
CAGCAACAAAAAAGCCTCAGTAACGAGCAATTCACTGTACCGAGATTACGTGGAGTCCATGCCAGCAAGG
CCGAACTGGCGACCATGTTGCCCTATCAGCAGGGGTTAATCCTGACGACCAGTAAAGACAGTTATTTTGA
AATTATGAAGGTCGATAAGCGCAATAACATGCTCACCCTCGCGGATATGAAAACTGGCGAGGAAAAGCAT
TTCTTCCCCAAAAATCATGGCCACAAATTCACGAACCTTTGGGCTAAGAGTGAGCAACCTCTCGCAGAAG
GCGACAGTATCATGCTCCGCAAAAGCGATATTGACCGTGAAATGCAGGGCAACAAAACCTATACCGTTAG
CCGCATTGACGATAAACAAATGCAGCTCAAATCCACGGATAACCACACATTAACGCTCTCAACCAAAGAG
TTGAAAGATGCTCATTGGGATTACGCATACACCCGCACCGCCGATATGGCGCAAGGGGCAACCTATGAGA
ATGTCATTACTGCGATTAAGGGCCAGGGTGCATTAACTAACGTAAGGCGCGCGTATATCGATATCACCCG
TGCCAGTAAGCACGTAAAAATCATCACCGATAACCCGCAAAAAATGATGCTCTCATGGGTCAATAACGAT
CCCAATAAAGTCTCTGCACTTGAGACAAGAGATAAATATTACCCTGAACATACCCCGCTATTTAATGACA
AACCTTTACCGCAGGAAAACCCAAAGTACCTCGATGTGAATGGATATGTGGATCTAAAACTGATGGCCAC
CGAGCTAAATGCCAAGCTTCCGGCCTACAGTGAATCACTGGCAACGCAGCTTTTAGGTGAGCCGAACCAC
GATAAATCAGACAAAGATAACCTGACATTTGGCAAAGAGGGGAGCCTAACATTGACCACAACGGGCCAAT
ATCGTGGCTATTTTAAAGACTGGAAAACCGGCGATAAAGGCACCTTAATCAACCTGATTATGGTCGCTGA
AAAGTGCAGTTATAAAGATGCACTTTATAAAGCCGATAAAATGATGAACGAACCCGATAAATATAATCTG
GTAAAAAACCCACAGCATGATGAATTAACACATGCCATTCCGGTTAAGCAAAGTCAATTAGAAGCGCGCG
CGAAGCAATACTTTAATGAAGCGAAACCTATCGAAAACTCACTCGCACAGACGTATTTAAACAAGCAAGG
CATCGACGTAAAGCAGCATGAAAACTTACGTTTTCACGATGCCGTTTATTCGTCAGAAAAACGTGGGACC
TTCCCCGCATTAATTGCGAACATCACCAATGATAAAGATGAGACTAAGGCGGTAGAAATTACTTACCTTG
ATAAATCCAGCGGTGACATTGCAGCGCTAAAAATAAATAAGCGCATACTCGGCTCTAAATCTGGGAACAG
CACGACGATCAACAAAGGCAATAATTCAGACTATAGTATTGTCGCTGTCGGTGTAGAGAACGCGCTTAAG
ATAAATGCTGACAATAAAAACGGGGCTGACGTTATTGCGCTAAACAATAATAATGACACTAAAACATTCA
ATACAAATGAATTGCGCGAAAACGTGATAGTGGTACTTGATACTAGTAATTCACAAGACACTGCAAAACT
GGCAAGTGACCTTACGGATAAATTCAGCAAGGAGAATATACATGCGGTTATTATTGAACCCAATCTGATA
CCTGACGGCTTAAACAAAGTCGAAACGACAAAACAATTAGTCAATGAAGCGGTCTATAGCATAACGACAA
AAGACAACACCCTATCTAAAGCCATTCAATCACTGAGTAATGATATTGCAGGCACAAAAAATATCACGAT
GAAGGATGACAGCACTAACGTAGCGACGAATAAAATAAAGCACGATGAACACTATCAACATTTAGCAATG
GATAGCCACCGTTCACCCACGAAAGAACATAGCCCCAACATCGACAATCCTAAATTGGATATTGGTGAAA
AAACAATGTAA
 Primer design