SecReT4
Protein ID: 217980272
T4SS name [ID]Tra_F [529]
Gene symbol-
Locus tagSbal223_4425
StrainShewanella baltica OS223
Repliconplasmid pS22302 [GenBank: NC_011668] [Browse all T4SS(s) in this replicon]
Location [Strand]10733..12856 [-]
Producttype IV conjugative transfer system coupling protein TraD
Component typeTraD_F
UniProt IDB8EFU0
KEGG IDsbp:Sbal223_4425
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 9.6e-158, Aligned region: 173..568
TraD_N [PF12615], Evalue: 1.8e-23, Aligned region: 37..129
TraG-D_C [PF12696], Evalue: 1.4e-22, Aligned region: 427..549
T4SS-DNA_transf [PF02534], Evalue: 2.1e-19, Aligned region: 229..562
AAA_10 [PF12846], Evalue: 1e-13, Aligned region: 190..502
Protein Sequence: 707 a.a.     [Download]
>gi|217980272|ref|YP_002364248.1| type IV conjugative transfer system coupling protein TraD [Shewanella baltica OS223]
MTLNPKRTKGSNYTRGGQILFHNLRMFLQINAVLIRWTCYGVLILTALLCYLFLDKDTLMGAYYYWINQT
VSVFRPDSHVMQTQWQGTVYTSTLGSQLENPTLIAANSRFWLWTQIYLLISCVIGIVFLSVAMWYFKKKG
DEQTEEHFIRGMQKATPKELAKQLKKDKRQSDFKLDGIGIFKERFEVQHLLLDGTTGAGKSVALRKFLTW
IRERGDKAIIYDKGCTFVSKFYNPATDVLLNPFDERCAYWDVWCDAHEPSDFENMASALIPQHGEGDPFW
VQSARTIFSSTAFKMQDEPKKNQTTERLLELMLTSELESLSEYLKGTESASLVSDKIQKTAISIKSVLAA
YIKSLRFLAGLDEKDEQGKLLRRKFSIREWVKNDAENGFLFLSSNAQQHASLRPLISMWLSIASTAILEQ
DEDPDRRIWVLMDEAPSLHKLPELAETIAEVRKFGGCYVIGIQSFAQLKKVYGENAALEMFDLLNTRLFF
RSPSNEMAKISSHDLGEQEVDVSKEQYSYGANEIRDGVSLGHQTITRPVVTPSEIMQLEDLQFWLRTPGN
YPVVRVDLVFNQMRSLCAPFIKRNYTPSENIKQIEWSLNYHQFSAVQHVDKADKTKLQSIHDTMYEGDEN
NDERSAEAQRMTKLAEKTDAVAQSLIDAKKAKPTELALKDAEKKKAAEKQKANDQHIEDAQRLEELQIVS
VEDAEIG
 
Nucleotide Sequence: 2124 bp     [Download]
>gi|217980264|ref|NC_011668.1|:c12856-10733 Shewanella baltica OS223 plasmid pS22302, complete sequence
GTGACCTTAAACCCCAAACGTACTAAAGGCAGTAACTACACCCGTGGTGGCCAGATTTTATTTCACAATT
TGCGGATGTTCCTGCAGATTAACGCCGTGCTTATCCGCTGGACGTGTTATGGCGTGCTCATCTTAACAGC
GCTGCTATGCTATCTCTTCCTTGATAAAGACACCTTAATGGGCGCTTATTATTATTGGATAAACCAAACG
GTTAGCGTGTTTAGACCAGACAGTCATGTTATGCAAACGCAGTGGCAAGGCACAGTCTATACCAGTACGT
TAGGGTCTCAATTAGAAAACCCGACACTGATTGCGGCCAACAGCCGCTTTTGGTTGTGGACACAAATTTA
TCTCCTTATAAGCTGTGTGATTGGCATCGTTTTTCTGTCCGTGGCCATGTGGTATTTCAAGAAAAAAGGG
GACGAGCAAACCGAGGAACACTTTATTCGGGGCATGCAAAAAGCCACGCCGAAAGAATTAGCAAAACAGC
TTAAAAAAGACAAGCGCCAATCCGATTTCAAGCTCGATGGCATTGGTATTTTCAAAGAACGCTTTGAAGT
ACAGCACTTGCTACTTGATGGCACCACGGGCGCGGGAAAGTCCGTGGCGCTGCGTAAGTTTTTAACGTGG
ATACGTGAACGGGGCGACAAAGCCATTATCTATGACAAAGGCTGTACCTTTGTCAGCAAGTTCTATAATC
CGGCAACGGACGTACTACTCAACCCGTTTGATGAACGCTGTGCTTACTGGGATGTGTGGTGTGATGCGCA
TGAACCCTCGGATTTTGAGAACATGGCAAGCGCGCTCATTCCCCAACACGGCGAGGGCGATCCATTTTGG
GTGCAATCTGCTCGCACCATTTTTTCATCTACTGCATTTAAGATGCAAGATGAACCTAAAAAGAACCAAA
CCACAGAACGACTGCTTGAACTCATGCTGACCAGCGAGCTTGAGTCCTTAAGTGAGTATCTTAAAGGGAC
CGAATCGGCCTCACTGGTATCCGATAAAATCCAAAAAACGGCGATATCCATTAAGTCGGTTCTCGCGGCT
TACATCAAATCATTACGATTCCTTGCCGGACTGGATGAAAAGGACGAACAGGGAAAACTCCTTCGCCGCA
AATTTTCAATTCGTGAGTGGGTGAAAAACGATGCCGAAAATGGCTTTCTATTTCTATCCAGTAACGCACA
GCAACATGCATCATTGCGCCCCTTGATCTCAATGTGGCTATCCATTGCATCGACCGCCATTTTAGAACAA
GACGAAGATCCCGACCGCAGAATTTGGGTGTTGATGGATGAAGCACCAAGCTTGCACAAGTTACCTGAAC
TTGCCGAAACAATCGCCGAAGTGCGTAAGTTCGGCGGTTGTTATGTCATAGGCATTCAGTCATTCGCGCA
GCTTAAAAAAGTCTATGGCGAAAATGCGGCACTTGAAATGTTCGACTTGCTCAACACTCGCTTATTTTTC
CGCTCACCCTCTAACGAAATGGCCAAAATCTCGTCTCACGATTTAGGCGAGCAAGAAGTTGATGTCTCTA
AAGAGCAATACAGCTACGGTGCTAATGAAATCAGGGATGGCGTATCACTGGGCCATCAAACCATTACCCG
CCCTGTGGTCACGCCCTCTGAAATCATGCAGCTTGAAGATTTACAATTTTGGCTACGCACGCCTGGCAAT
TATCCCGTGGTAAGAGTGGATTTAGTCTTTAACCAAATGCGCTCACTGTGCGCCCCGTTTATCAAACGTA
ACTACACCCCGTCTGAAAACATAAAGCAGATTGAATGGAGTCTGAACTATCACCAGTTCAGTGCGGTTCA
ACACGTCGATAAAGCGGATAAAACCAAGCTCCAAAGCATTCATGACACCATGTATGAAGGTGATGAAAAC
AATGATGAACGCAGCGCGGAAGCGCAGCGCATGACCAAACTTGCTGAAAAAACCGATGCGGTCGCCCAAA
GCCTCATCGATGCGAAAAAGGCCAAACCGACTGAGTTAGCGCTCAAGGATGCAGAGAAGAAAAAAGCCGC
TGAAAAACAAAAGGCCAATGACCAGCACATTGAGGATGCACAGCGACTTGAAGAGCTGCAAATCGTGTCT
GTAGAAGACGCAGAAATTGGTTAA
 Primer design