SecReT4
Protein ID: 217980274
T4SS name [ID]Tra_F [529]
Gene symbol-
Locus tagSbal223_4427
StrainShewanella baltica OS223
Repliconplasmid pS22302 [GenBank: NC_011668] [Browse all T4SS(s) in this replicon]
Location [Strand]13430..16243 [-]
ProductTraG domain protein
Component typeTraG_F
UniProt IDB8EFU2
KEGG IDsbp:Sbal223_4427
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.3e-117, Aligned region: 4..456
Protein Sequence: 937 a.a.     [Download]
>gi|217980274|ref|YP_002364250.1| TraG domain protein [Shewanella baltica OS223]
MAVEIFTYSNGDVAKQVMNAIAVLFKSDSFASMISICALFAVVATALHFFIKRDHNAIMKWCAVYFAVPL
LAMNTTATVQITDLTNPTGNYRVDNVPAIVAFPASWASHYMYATTQTVEDIFHVPDDQQYSKTGMMFGSE
LYKLSRQSEIENTQLKGYWQHYISSCIRGDMLLNHKYTWRDLANAPDIWDFLATHNPSPLRAIQMGPNDY
PTCKEALPRLKQLFQADSAKSIKLLGSWIYGEKAKSQQSFLNTSISGGYQKYANISQSASQITLQNMTIN
ALRNGLADDAAVSNNTAAAFNYAYTQNKMQTTSMWAGMALQAREFLPMLQSILFLLFSSVAFLVVAIAMI
PSLTFQVLGNYFKGFIYLGTWPVMFALINFIMTTRLSLNATEITNIYGGITLSNVDPLQEMHSRYAAMTG
FLMMSVPTLIVPLIMKGGASVMSSMSHQFAGMMSSVNARTSASAASGDINLGNAQVDNYSYNNTNGNKID
TTGVERIHGNTKQDATGYETTTFDDGRQVINGQNALSRSLPVNISGSDVVTNSASQSASNAISASKIEGK
QASESIATSTNTALSQMSGVNTSNSYGSNSATGDSGTHNKGFADMRSTVKSFAKDFNLTEDQATSTLLSM
YVGAEAGVKLGTPGSGFLGSSAHVSGSTGTKGSTDDVSTARTSESERDSLQQSYLDQFSANVNTVKSYNS
GEQASTTNSKNEGETQTFLQGLNEAITHTKNAQSQLTEAQSYTDLANNVKSGSISIGRDFNQDFVDYVQD
ARDKQGDFMEVIKGQTPEMQQERNQLAAEFTNSPKVKAMVEQYKNNELPQNRDDIMQAQERYAADIDFNK
QQSPQYAPAPFNDSLYQTGEFERIQGHAAQGNAEIRQDVLHEEQTHNASSVPSIDMEQARADAKAAHALI
KPDNRSDDEKMAETVRQSSPFNTGPKM
 
Nucleotide Sequence: 2814 bp     [Download]
>gi|217980264|ref|NC_011668.1|:c16243-13430 Shewanella baltica OS223 plasmid pS22302, complete sequence
ATGGCAGTTGAGATTTTCACCTACAGCAACGGTGACGTGGCCAAGCAAGTGATGAATGCCATTGCCGTGC
TGTTCAAGTCCGATTCATTTGCCAGCATGATAAGCATCTGTGCGCTGTTTGCCGTGGTGGCCACCGCGCT
GCACTTTTTCATCAAGCGTGACCATAACGCGATTATGAAATGGTGCGCGGTTTACTTTGCCGTGCCATTG
CTTGCCATGAACACCACCGCCACGGTGCAAATTACCGATTTAACCAATCCGACGGGTAACTATCGCGTGG
ACAATGTGCCCGCGATTGTGGCGTTTCCGGCCTCATGGGCATCGCATTATATGTATGCCACCACCCAAAC
GGTGGAAGATATTTTTCACGTACCGGATGATCAACAATACAGTAAAACGGGCATGATGTTTGGCTCTGAG
CTGTACAAGTTATCCAGACAAAGCGAGATAGAAAACACCCAACTTAAAGGCTATTGGCAGCACTACATCA
GCAGTTGTATTCGCGGAGATATGCTACTCAATCATAAATACACATGGCGAGATTTAGCCAATGCGCCGGA
CATTTGGGACTTTCTAGCCACTCACAACCCTTCGCCGCTACGGGCGATTCAAATGGGCCCTAATGACTAT
CCTACCTGCAAAGAAGCCCTTCCGCGCCTCAAGCAACTTTTCCAAGCTGACAGCGCAAAAAGCATCAAGT
TACTGGGCAGTTGGATTTATGGTGAAAAGGCCAAAAGCCAACAAAGCTTTTTGAATACCAGCATCAGTGG
TGGTTATCAAAAGTACGCCAATATCAGTCAAAGCGCGTCGCAAATCACGCTGCAAAACATGACGATTAAC
GCCTTGCGAAATGGCCTCGCGGATGATGCAGCGGTGAGCAACAACACCGCCGCCGCATTCAACTACGCCT
ATACACAAAACAAAATGCAAACCACATCGATGTGGGCGGGAATGGCCCTGCAGGCGCGCGAATTTTTGCC
CATGCTGCAATCAATTTTGTTTTTGCTGTTTAGCTCTGTCGCCTTTTTAGTGGTGGCGATTGCCATGATC
CCCTCACTCACGTTTCAAGTGCTCGGCAACTATTTCAAAGGCTTTATCTACCTTGGCACATGGCCGGTGA
TGTTTGCCCTCATCAACTTCATCATGACCACGCGCTTATCCCTTAACGCCACCGAAATCACTAACATTTA
CGGCGGTATCACCTTAAGCAACGTAGATCCCTTACAAGAAATGCACTCCCGCTATGCCGCCATGACCGGC
TTTTTAATGATGAGCGTACCGACATTAATTGTCCCGCTCATTATGAAAGGCGGCGCGTCGGTAATGAGCA
GTATGTCGCATCAGTTCGCGGGCATGATGAGCAGCGTTAACGCGCGCACCTCTGCGAGTGCGGCAAGTGG
TGATATCAATTTGGGTAACGCTCAGGTGGATAACTACAGCTACAACAACACCAACGGCAATAAAATCGAC
ACCACTGGCGTTGAACGCATTCATGGCAACACCAAGCAAGATGCAACCGGCTATGAGACCACCACCTTTG
ACGATGGCAGACAAGTCATTAATGGCCAAAATGCCTTAAGTCGTAGCTTGCCAGTGAACATCAGCGGCAG
TGACGTGGTGACGAACTCGGCCTCGCAATCTGCCTCAAACGCGATCAGTGCGAGCAAAATAGAGGGTAAA
CAAGCAAGCGAAAGTATCGCCACCTCCACGAATACCGCACTAAGTCAAATGAGCGGGGTCAATACCTCGA
ACAGTTATGGCAGCAATAGCGCCACCGGCGACAGTGGCACTCATAACAAAGGCTTCGCAGATATGCGTAG
TACGGTTAAGTCTTTTGCTAAGGACTTCAACCTGACAGAAGACCAAGCCACAAGTACCTTATTATCGATG
TATGTCGGAGCAGAAGCAGGCGTGAAACTCGGCACACCTGGGAGTGGATTTCTTGGCTCTAGTGCGCACG
TATCCGGCTCTACCGGCACTAAAGGCTCAACCGATGATGTCAGCACAGCCCGTACCAGTGAAAGCGAACG
TGACAGTCTCCAGCAAAGCTACCTTGACCAGTTCAGCGCTAACGTTAACACCGTCAAATCCTATAACAGC
GGCGAACAAGCCAGTACAACCAACAGTAAAAACGAAGGTGAAACCCAAACCTTCCTACAAGGGCTTAACG
AAGCGATTACCCACACCAAAAACGCCCAATCCCAGCTCACCGAAGCCCAAAGTTACACTGACCTCGCCAA
TAATGTCAAAAGTGGCTCAATCAGTATTGGGCGTGACTTTAATCAAGATTTTGTTGATTACGTACAAGAC
GCAAGAGATAAGCAAGGTGATTTCATGGAGGTGATCAAAGGACAAACACCAGAAATGCAGCAAGAGCGAA
ACCAACTCGCGGCCGAATTTACGAACAGCCCGAAAGTCAAAGCGATGGTAGAGCAATACAAGAACAATGA
ATTACCGCAAAACCGAGATGACATTATGCAAGCTCAGGAGCGTTACGCCGCTGACATTGATTTCAATAAA
CAGCAATCACCACAGTATGCCCCAGCGCCGTTCAATGACAGCCTCTATCAAACGGGCGAATTTGAGCGCA
TCCAAGGCCATGCGGCGCAAGGCAATGCGGAAATTAGACAAGATGTGTTGCACGAAGAACAGACTCATAA
CGCGTCTAGCGTCCCGAGCATTGATATGGAACAGGCCCGTGCTGACGCAAAAGCGGCGCACGCCCTAATA
AAGCCAGACAATCGAAGTGACGATGAAAAAATGGCAGAAACAGTGCGTCAATCAAGTCCCTTTAATACAG
GACCAAAAATGTGA
 Primer design