SecReT4
Protein ID: 217980275
T4SS name [ID]Tra_F [529]
Gene symbol-
Locus tagSbal223_4428
StrainShewanella baltica OS223
Repliconplasmid pS22302 [GenBank: NC_011668] [Browse all T4SS(s) in this replicon]
Location [Strand]16246..17634 [-]
ProductTraH family protein
Component typeTraH_F
UniProt IDB8EFU3
KEGG IDsbp:Sbal223_4428
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 1.1e-116, Aligned region: 32..385
Protein Sequence: 462 a.a.     [Download]
>gi|217980275|ref|YP_002364251.1| TraH family protein [Shewanella baltica OS223]
MKRLALTRTLLGVTISCLLTTHAHSAGVSGSLNDFFNGLGYGTNVTNPGSFKGQSANYYSGGNLFVRSPI
RDAQLVSVQMPSIAAGCGGIDMFMGGFSHINSDALVQQGKAIIANAAPFAVDLALQTWAPQIKQIKDTLT
AIADKYLNQSINSCESAQAGVSALAGFAGVGSQKYICATMGTQNNAFADWVSGQQECGAGGQANNQLDNA
KKDPALKDMVRKNTNIVWAAILKNTFLASDPTLAEFLMSISGTYIYDATGNARGYGSLLTDNNNLINSLL
EGGKAESYQCTNQAIDQCLAPTQQTITIQSNHGLQYRVETLLRGIASKMQNDQPLTDNDKSLLEYTTLPI
MTFLRTELEAGLTPQTNTYAKIISVQFITLYLQNMLSIVKSSITATNNDPKDIDRIERDIINANRFLEGL
TAKAQNEAVSQHQLIMQNQQIKQQITGAMSAKAKANLNFGER
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|217980264|ref|NC_011668.1|:c17634-16246 Shewanella baltica OS223 plasmid pS22302, complete sequence
ATGAAACGCTTAGCACTGACGCGCACACTACTGGGCGTCACTATTTCATGCTTGCTGACAACCCACGCGC
ATAGTGCGGGGGTTTCAGGTTCGCTAAACGATTTCTTCAATGGCCTAGGCTATGGCACGAACGTGACCAA
TCCGGGCTCATTCAAAGGCCAAAGCGCCAACTACTACAGCGGCGGCAATTTATTTGTGCGTAGCCCCATT
CGCGACGCGCAGCTCGTGAGTGTGCAAATGCCCAGCATTGCCGCAGGCTGTGGCGGTATTGATATGTTTA
TGGGGGGATTCAGCCACATTAACTCTGACGCCCTTGTGCAACAAGGCAAGGCTATTATCGCCAACGCTGC
ACCGTTCGCCGTCGATTTAGCCCTGCAGACGTGGGCACCACAAATCAAACAGATTAAGGACACGCTAACG
GCCATTGCTGATAAGTACCTCAATCAGTCGATCAATTCTTGCGAGAGTGCCCAAGCGGGTGTCTCGGCAC
TGGCGGGGTTTGCAGGTGTTGGCAGTCAAAAATACATTTGTGCCACCATGGGCACACAAAATAACGCGTT
TGCGGATTGGGTATCTGGCCAGCAAGAATGCGGCGCGGGCGGTCAAGCTAACAATCAGCTCGATAACGCC
AAGAAAGATCCCGCACTAAAAGACATGGTGCGCAAAAATACCAATATTGTGTGGGCCGCCATTTTAAAAA
ATACCTTCCTTGCCAGCGATCCGACCTTGGCAGAATTTCTCATGTCGATTTCAGGCACTTACATTTATGA
CGCGACCGGCAATGCGCGCGGTTATGGCTCACTGCTGACCGACAACAATAACCTGATTAATAGTCTGTTA
GAGGGCGGCAAAGCTGAAAGTTATCAATGCACCAATCAAGCCATTGACCAATGCTTAGCACCGACACAAC
AAACGATCACCATCCAAAGTAATCACGGCCTGCAATACCGCGTAGAAACCTTACTCAGAGGTATCGCCAG
CAAGATGCAAAACGACCAGCCACTAACAGATAACGACAAGTCGCTGCTCGAATACACGACACTGCCCATC
ATGACCTTTTTACGCACTGAACTAGAAGCAGGACTCACGCCCCAAACCAATACTTACGCCAAAATCATCA
GCGTGCAGTTTATTACCCTCTATCTGCAAAACATGCTGTCGATTGTGAAATCCTCTATCACGGCAACCAA
CAATGATCCCAAAGACATTGATCGTATCGAGCGTGACATTATCAACGCCAACCGCTTTTTAGAAGGACTC
ACCGCTAAAGCTCAAAATGAGGCCGTATCGCAGCATCAGCTCATTATGCAAAACCAGCAAATCAAACAGC
AAATAACGGGCGCCATGAGCGCTAAAGCTAAGGCCAACTTGAATTTTGGGGAGCGATAA
 Primer design