SecReT4
Protein ID: 217980279
T4SS name [ID]Tra_F [529]
Gene symbol-
Locus tagSbal223_4432
StrainShewanella baltica OS223
Repliconplasmid pS22302 [GenBank: NC_011668] [Browse all T4SS(s) in this replicon]
Location [Strand]19040..19915 [-]
Producttype-F conjugative transfer system pilin assembly protein TraF
Component typeTraF_F
UniProt IDB8EFU7
KEGG IDsbp:Sbal223_4432
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 5.8e-69, Aligned region: 63..281
Protein Sequence: 291 a.a.     [Download]
>gi|217980279|ref|YP_002364255.1| type-F conjugative transfer system pilin assembly protein TraF [Shewanella baltica OS223]
MRTLLNNRLQHAAASPFFRWSSRAPLAWLSTKNGDAVVNKRSALVLLMLTTFCHGANATDAQGWRWYNEP
TAPKKQAPKKAETPSVTLTRTKTLTPTEQMDWFHSYYQDTLNDAAINSQDSEKVEKAMLLNQYVSNKSSE
FGMTFKKVLLDNPELSYTKDRPTEQAARSTYLSLERNKKMRAVRSLADAGWGLFFVYKGQEEMDIALAPS
VQQFATEHGIELLGVTLDGVALPAIVQNRQNDQHINVPFSPALVLVNPGTGEMKPLAYGFISQDDLLGRF
LNVATDFAPDF
 
Nucleotide Sequence: 876 bp     [Download]
>gi|217980264|ref|NC_011668.1|:c19915-19040 Shewanella baltica OS223 plasmid pS22302, complete sequence
ATGAGGACGTTGTTAAATAACCGCTTACAACATGCCGCAGCATCTCCTTTTTTTCGGTGGTCAAGCCGCG
CGCCGTTGGCGTGGTTGTCCACAAAAAATGGGGATGCAGTGGTCAACAAGCGCAGCGCGTTAGTGCTCCT
TATGCTGACAACGTTTTGCCACGGTGCAAACGCCACGGATGCACAAGGGTGGCGCTGGTATAACGAACCG
ACAGCCCCCAAGAAGCAAGCGCCTAAAAAGGCCGAAACGCCAAGCGTCACACTCACGCGCACCAAAACGC
TGACGCCCACCGAGCAGATGGATTGGTTCCACAGCTACTACCAAGACACGCTCAATGACGCGGCGATAAA
CAGCCAAGACAGCGAGAAAGTGGAAAAGGCCATGCTGCTTAATCAGTACGTCAGTAATAAATCGTCAGAG
TTTGGCATGACCTTCAAAAAGGTCCTGCTGGATAACCCTGAGCTGTCTTACACCAAAGATAGACCGACGG
AACAAGCGGCAAGAAGCACCTATTTATCATTAGAGCGCAACAAGAAGATGCGCGCAGTACGCAGCCTTGC
CGATGCGGGATGGGGGCTGTTCTTTGTCTACAAAGGCCAAGAAGAAATGGATATTGCGCTAGCGCCCAGC
GTGCAGCAATTCGCTACTGAGCATGGCATTGAGCTACTTGGCGTCACGCTCGATGGTGTAGCACTGCCAG
CCATCGTGCAGAACCGCCAAAACGACCAGCACATAAACGTCCCGTTTAGTCCCGCACTCGTGTTAGTTAA
TCCTGGCACGGGGGAAATGAAACCGCTCGCGTATGGCTTTATCTCTCAAGACGATTTACTGGGCCGTTTC
CTGAACGTGGCCACCGATTTCGCCCCTGACTTTTAA
 Primer design