SecReT4
Protein ID: 217980280
T4SS name [ID]Tra_F [529]
Gene symbol-
Locus tagSbal223_4433
StrainShewanella baltica OS223
Repliconplasmid pS22302 [GenBank: NC_011668] [Browse all T4SS(s) in this replicon]
Location [Strand]19912..21729 [-]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDB8EFU8
KEGG IDsbp:Sbal223_4433
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 8.4e-69, Aligned region: 318..560
Protein Sequence: 605 a.a.     [Download]
>gi|217980280|ref|YP_002364256.1| conjugal transfer mating pair stabilization protein TraN [Shewanella baltica OS223]
MTQLNNALILSAILTLSAALPVMAANSEKDYRDNVQWAKDSIKQNQNKAGYTGFDVNSLCKDATCQQEVA
NPSESRYYNNPSAMDSAKMQGMSTDGQAQAVTSGFNNGRPTIDENDPAYHTAVGYQNDAYNISHGISSKY
HDCEKGLVCEVDSQPRSCTLPTNNPVQCYLTPFVKSTSTREKEHSFRLSGKPPFTITLPNPNAEIKRIRF
NGDYSSWGGATKLEIKLNDIYIGHIPSQRAAGDCIVNGFCPSSVNATLSTDNYQGGTSPLTVNIGTILGG
TWDWAFYLPIENLPITFVTTESDVEIGYNNSCGAVLPECQQVQSQCIEGKETRMINGISVTLDCWKEETT
YQCAFPNTCDAIADCSIQSTSCDTQLGGVCIKDKQQRLCDKQQCRDTGLICGADSFALSGDYYDPAATRS
TDFNHAAAGLAAVSDAAGDVKDKANINENSAIIFKGNIMECSDKALGISNCCQDSGWGNGIGLTSCSEEE
KALGTAKEDKLTVSLGQYCAEKVLGVCIRKKKAYCAFDSKLARIVQVEGRAQLGKNFGSAKHPDCSAFSP
NELQRIDMSSMDFSDFYEDMYDAIELPSTDEIQKRLQQSVGGTKP
 
Nucleotide Sequence: 1818 bp     [Download]
>gi|217980264|ref|NC_011668.1|:c21729-19912 Shewanella baltica OS223 plasmid pS22302, complete sequence
ATGACTCAGTTGAATAATGCCTTAATCCTCAGTGCCATCCTCACATTGAGTGCCGCCTTGCCTGTTATGG
CGGCAAACAGCGAAAAGGATTACCGCGATAATGTGCAGTGGGCCAAAGACAGTATCAAGCAGAATCAGAA
CAAAGCGGGTTACACCGGTTTTGACGTTAACAGCCTATGCAAAGATGCGACATGTCAGCAAGAAGTCGCT
AACCCAAGCGAAAGCCGTTACTACAACAACCCGAGCGCCATGGACAGTGCCAAAATGCAAGGCATGAGCA
CGGATGGCCAAGCCCAAGCCGTGACGAGTGGCTTTAATAATGGCCGCCCGACGATTGATGAAAACGATCC
GGCATACCATACCGCCGTTGGCTATCAAAATGATGCTTACAATATCAGCCACGGCATTTCATCTAAATAT
CATGACTGTGAAAAAGGGCTCGTTTGTGAAGTCGATTCTCAGCCACGTTCTTGCACGTTGCCCACCAATA
ATCCGGTGCAATGCTACCTAACACCCTTTGTCAAAAGCACGTCAACGCGTGAAAAAGAGCACTCATTCCG
GTTGTCAGGTAAGCCGCCATTTACCATTACACTGCCTAATCCCAACGCTGAAATTAAACGGATACGATTC
AACGGCGATTACTCAAGTTGGGGTGGCGCGACAAAACTTGAAATCAAACTTAATGACATCTATATCGGCC
ACATTCCTTCACAACGCGCCGCTGGTGACTGCATTGTAAATGGCTTTTGTCCCTCAAGTGTCAACGCCAC
CTTAAGCACTGATAACTATCAAGGCGGTACATCACCACTTACAGTCAATATTGGCACTATTCTGGGTGGT
ACATGGGATTGGGCTTTTTACCTCCCAATCGAAAATCTACCGATCACATTCGTGACAACAGAAAGCGACG
TTGAAATTGGCTACAACAACAGTTGCGGCGCAGTCCTCCCCGAGTGCCAACAAGTCCAATCTCAATGTAT
TGAAGGTAAAGAAACACGCATGATTAATGGGATCAGCGTGACATTGGATTGCTGGAAAGAAGAAACCACC
TATCAATGTGCCTTTCCCAATACCTGCGACGCCATCGCAGATTGCAGTATTCAATCGACCAGTTGTGACA
CCCAACTTGGCGGCGTTTGCATTAAAGATAAACAACAACGCCTATGTGATAAACAGCAATGCCGTGATAC
GGGCCTTATCTGCGGTGCAGACAGCTTTGCGCTCAGTGGTGACTATTACGATCCTGCGGCCACTCGCAGC
ACTGACTTTAACCATGCTGCGGCAGGACTGGCCGCCGTCAGTGACGCAGCCGGTGATGTGAAAGACAAAG
CCAACATCAACGAAAACAGCGCCATCATTTTCAAAGGCAACATCATGGAATGCAGCGATAAAGCGCTGGG
GATAAGCAATTGTTGTCAGGACAGCGGTTGGGGTAACGGCATCGGCTTAACGTCCTGCAGTGAAGAAGAA
AAAGCGCTGGGCACTGCCAAAGAAGACAAGCTCACCGTATCACTTGGCCAATATTGCGCTGAGAAAGTAC
TTGGCGTGTGTATCCGCAAGAAAAAAGCCTATTGCGCGTTTGATAGCAAACTCGCGCGCATTGTGCAGGT
TGAAGGCCGCGCGCAATTGGGTAAAAACTTTGGCAGCGCCAAGCATCCTGATTGCAGCGCCTTTTCCCCC
AACGAACTGCAACGCATTGATATGTCGTCAATGGACTTTTCTGATTTTTATGAAGACATGTACGACGCCA
TCGAACTGCCCAGCACTGACGAAATTCAAAAACGCTTACAACAGTCGGTTGGAGGAACCAAACCATGA
 Primer design