SecReT4
Protein ID: 217980281
T4SS name [ID]Tra_F [529]
Gene symbol-
Locus tagSbal223_4434
StrainShewanella baltica OS223
Repliconplasmid pS22302 [GenBank: NC_011668] [Browse all T4SS(s) in this replicon]
Location [Strand]21726..22466 [-]
Producttype-F conjugative transfer system pilin assembly protein TrbC
Component typeTrbC_F
UniProt IDB8EFU9
KEGG IDsbp:Sbal223_4434
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 4.7e-32, Aligned region: 116..227
Protein Sequence: 246 a.a.     [Download]
>gi|217980281|ref|YP_002364257.1| type-F conjugative transfer system pilin assembly protein TrbC [Shewanella baltica OS223]
MKKFETKLPTTYTALCTKIVDNSLFSHSFKGLALLMSLLCLGSISQVFAQTDYSIDELKALSMRERHTLP
PLNVDQAALFDKARQFEAQSKGQLDNALSPLLDAKPNPSADANGVMVFVSLGMPATSLQQLLMQSADLQV
PLIVRGVLPQGFTATVKQMNHLIDNKGKTIQSGFAINPQWFTQFGITQVPAFVAVRPNKCQAKQPCSSDD
FDVIYGNVSLYDALNLLAQHGSIPDVAAKTLAKGAK
 
Nucleotide Sequence: 741 bp     [Download]
>gi|217980264|ref|NC_011668.1|:c22466-21726 Shewanella baltica OS223 plasmid pS22302, complete sequence
ATGAAAAAGTTTGAGACCAAATTACCAACAACATATACCGCTTTATGCACAAAAATTGTGGATAACAGCC
TATTTTCACATTCATTTAAAGGCTTAGCCCTGCTCATGAGCTTATTGTGCCTTGGATCAATTTCACAGGT
GTTCGCCCAAACGGATTACAGTATTGACGAATTAAAAGCGCTGTCGATGCGAGAACGCCACACATTACCC
CCACTGAACGTAGACCAAGCCGCACTGTTTGATAAAGCTCGTCAGTTCGAAGCGCAAAGCAAAGGCCAAT
TAGACAACGCGCTATCACCATTGCTCGATGCAAAGCCCAACCCCAGTGCCGATGCTAATGGTGTGATGGT
ATTTGTGTCGTTGGGTATGCCTGCCACCAGTTTGCAGCAATTGCTCATGCAAAGCGCAGACTTACAAGTG
CCACTCATTGTGCGCGGTGTACTGCCTCAAGGCTTTACCGCCACCGTTAAACAGATGAACCACCTCATCG
ATAACAAGGGTAAAACCATACAGAGCGGTTTTGCGATTAATCCCCAGTGGTTTACGCAATTCGGCATTAC
CCAAGTACCCGCCTTTGTTGCTGTAAGACCCAACAAATGTCAGGCAAAACAGCCCTGCAGCAGCGATGAC
TTTGACGTGATTTACGGCAACGTTTCGTTGTATGACGCGCTGAACTTACTTGCACAACACGGCAGCATTC
CCGATGTGGCGGCGAAGACATTAGCAAAGGGGGCGAAATGA
 Primer design