SecReT4
Protein ID: 217980282
T4SS name [ID]Tra_F [529]
Gene symbol-
Locus tagSbal223_4435
StrainShewanella baltica OS223
Repliconplasmid pS22302 [GenBank: NC_011668] [Browse all T4SS(s) in this replicon]
Location [Strand]22489..23502 [-]
ProductTraU family protein
Component typeTraU_F
UniProt IDB8EFV0
KEGG IDsbp:Sbal223_4435
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.9e-79, Aligned region: 31..336
Protein Sequence: 337 a.a.     [Download]
>gi|217980282|ref|YP_002364258.1| TraU family protein [Shewanella baltica OS223]
MRHIKLAWLVALSLLMGLIPSQANAQAACTGTFVNPMTDICWSCIFPMTIGSVPIIPGSLPDTRNPVSPI
SFCPKPPPIFMQIGLNIGYWEPDTLVDVTRVPYCMVNMGMKLDMSNSPQIGGRVTSRDNDASDGAFYHGH
WYKYPVIYWLQIMQSAACMATDNFDIAYLTEIDPLWDDDELSFILNPEAILFGNLVSQLACATEAVATST
NSILPFDFLFWCMGSQGSAYPLTGTTNYRDTPIQAGTLILERLNYKLHRQGIVWESHGEDGAICYQTPMP
LMPKSRYRYQMTNTIPDALWAHPYTTTTVIWESGHDNPVSGDNFGFINFKKRNCVFL
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|217980264|ref|NC_011668.1|:c23502-22489 Shewanella baltica OS223 plasmid pS22302, complete sequence
ATGCGGCACATTAAACTCGCGTGGCTTGTAGCCTTATCTTTATTGATGGGTCTAATTCCTTCACAAGCCA
ACGCACAGGCCGCCTGTACGGGCACATTCGTTAACCCGATGACCGACATTTGTTGGTCGTGTATCTTCCC
GATGACCATTGGCAGTGTGCCTATTATTCCTGGGAGCCTACCCGATACGCGCAACCCCGTATCACCCATT
TCATTTTGTCCCAAACCGCCGCCTATTTTTATGCAAATTGGCTTGAATATCGGCTACTGGGAGCCTGATA
CCTTAGTGGACGTGACGCGCGTCCCTTACTGCATGGTCAACATGGGCATGAAGCTCGACATGAGTAATTC
CCCCCAAATTGGCGGTCGCGTTACAAGTCGCGATAACGATGCCAGTGATGGCGCGTTTTATCATGGGCAC
TGGTACAAATACCCAGTAATTTATTGGCTGCAAATTATGCAAAGCGCAGCCTGTATGGCCACAGACAATT
TCGACATTGCCTATTTAACAGAGATAGATCCACTGTGGGATGATGACGAGTTGTCATTTATCCTCAATCC
CGAAGCCATTTTATTTGGCAATTTAGTGTCACAACTCGCCTGTGCAACCGAAGCCGTGGCCACCTCAACT
AACAGCATATTGCCTTTTGATTTTCTGTTTTGGTGTATGGGCTCACAAGGCAGTGCCTACCCCCTGACTG
GCACCACCAATTACCGCGACACGCCCATTCAGGCGGGTACGTTGATTTTAGAGCGCCTGAACTACAAATT
GCATCGCCAAGGCATCGTATGGGAATCCCACGGTGAAGACGGCGCAATTTGCTATCAAACGCCGATGCCC
CTCATGCCCAAATCCCGCTATCGCTATCAAATGACCAACACCATACCCGATGCGCTATGGGCGCACCCTT
ACACCACGACAACGGTGATCTGGGAAAGTGGCCACGACAACCCTGTGTCGGGTGACAACTTTGGTTTTAT
CAACTTCAAAAAACGCAATTGCGTGTTTTTGTGA
 Primer design