SecReT4
Protein ID: 217980283
T4SS name [ID]Tra_F [529]
Gene symbol-
Locus tagSbal223_4436
StrainShewanella baltica OS223
Repliconplasmid pS22302 [GenBank: NC_011668] [Browse all T4SS(s) in this replicon]
Location [Strand]23489..24193 [-]
Producttype-F conjugative transfer system protein TraW
Component typeTraW_F
UniProt IDB8EFP3
KEGG IDsbp:Sbal223_4380, sbp:Sbal223_4436
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 234 a.a.     [Download]
>gi|217980283|ref|YP_002364259.1| type-F conjugative transfer system protein TraW [Shewanella baltica OS223]
MNKFALLMLALCPLLPLKAASIGTVGQVFPIAEIDMLQWIENRLQTLEKTGELDSMREQFQENVKAGVKR
PRPVGLITTKTPEVFLVDPTLTLAKDINDANGNLIYPKGTRVNPFDTKTWPALQKANVGKFEFSKTLVFF
DGDDVQQVLWAKEFATTHDKPHTIKWILTGGEPETLHGQLDARVYFDQQGNLSRALTLKRVPSVVKQAGV
MWQVREMDVSNFPVFMEETNNAAH
 
Nucleotide Sequence: 705 bp     [Download]
>gi|217980264|ref|NC_011668.1|:c24193-23489 Shewanella baltica OS223 plasmid pS22302, complete sequence
ATGAATAAATTCGCGCTTCTGATGTTGGCGTTATGCCCACTATTACCGCTCAAGGCTGCGTCTATCGGCA
CCGTGGGGCAAGTGTTCCCGATTGCTGAAATTGACATGCTGCAGTGGATTGAAAACCGTCTGCAAACCTT
AGAGAAAACGGGTGAGCTAGACAGTATGCGCGAGCAATTCCAAGAGAATGTCAAAGCCGGTGTTAAGCGC
CCTCGTCCGGTGGGGCTCATTACCACTAAAACCCCTGAGGTGTTTTTGGTCGATCCCACCTTAACGCTGG
CCAAAGATATCAATGATGCGAATGGCAACCTGATTTATCCCAAAGGGACGCGCGTAAACCCATTTGACAC
CAAGACATGGCCAGCATTGCAAAAGGCCAACGTCGGCAAGTTTGAGTTCAGTAAAACGCTGGTGTTTTTT
GATGGGGATGATGTGCAGCAAGTGTTATGGGCCAAAGAGTTTGCAACAACCCATGACAAGCCACACACCA
TCAAATGGATTTTAACGGGCGGCGAACCCGAAACACTGCATGGCCAATTAGATGCGCGCGTTTACTTTGA
CCAGCAAGGAAACCTCAGCCGCGCCTTAACACTTAAGCGCGTTCCAAGTGTCGTGAAGCAAGCGGGCGTG
ATGTGGCAAGTGCGCGAAATGGATGTGTCCAATTTCCCCGTATTCATGGAGGAAACAAACAATGCGGCAC
ATTAA
 Primer design